Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|029270
Gene name
Locationscaffold_12:309630..310125
Strand-
Gene length (bp)495
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.8E-05 21 65

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5917 0.2754 0.1913 0.0994 0.4127 0.0077 0.0507 0.1333 0.0467 0.0083

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup7247
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|029270
Agaricus bisporus var bisporus H97 AgabiH97|029270 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|76_10

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|029270
MSTFEWSTPTRRSSTGPLNPLPLEVYQEILSHFQENDDMTASEVRRHLCNMALVCRYFSSIALPRIFAELNIPNG
CGDTSINRFCRALANNKEPAASLARYIKTCNFAASMPCEGSLRTQEAFFFISRNR*
Coding >AgabiH97|029270
ATGTCAACATTCGAGTGGTCAACTCCTACTCGGAGGTCCAGTACTGGGCCGCTGAACCCACTACCTCTCGAAGTG
TACCAGGAGATTCTTAGCCACTTTCAAGAGAACGACGACATGACAGCTTCGGAAGTTCGGCGACATCTTTGCAAT
ATGGCCCTCGTCTGCCGGTACTTCTCATCCATCGCACTGCCACGCATATTTGCCGAATTGAATATTCCTAACGGA
TGCGGGGACACATCTATAAACCGGTTTTGTCGCGCCCTCGCTAATAACAAAGAACCTGCAGCTAGTCTGGCACGA
TACATCAAAACGTGCAATTTTGCTGCTTCCATGCCATGCGAAGGTTCGCTTCGAACTCAGGAAGCTTTCTTTTTC
ATATCGCGTAACCGTTGA
Transcript >AgabiH97|029270
ATGTCAACATTCGAGTGGTCAACTCCTACTCGGAGGTCCAGTACTGGGCCGCTGAACCCACTACCTCTCGAAGTG
TACCAGGAGATTCTTAGCCACTTTCAAGAGAACGACGACATGACAGCTTCGGAAGTTCGGCGACATCTTTGCAAT
ATGGCCCTCGTCTGCCGGTACTTCTCATCCATCGCACTGCCACGCATATTTGCCGAATTGAATATTCCTAACGGA
TGCGGGGACACATCTATAAACCGGTTTTGTCGCGCCCTCGCTAATAACAAAGAACCTGCAGCTAGTCTGGCACGA
TACATCAAAACGTGCAATTTTGCTGCTTCCATGCCATGCGAAGGTTCGCTTCGAACTCAGGAAGCTTTCTTTTTC
ATATCGCGTAACCGTTGA
Gene >AgabiH97|029270
ATGTCAACATTCGAGTGGTCAAGTAAGTGATCATTTATATATATAGATTTAGACTGGAACTCAACTTCTTGTAGC
TCCTACTCGGAGGTCCAGTACTGGGCCGCTGAACCCACTACCTCTCGAAGTGTACCAGGAGATTCTTAGCCACTT
TCAAGAGAACGACGACATGACAGCTTCGGAAGTTCGGCGACATCTTTGCAATATGGCCCTCGTCTGCCGGTACTT
CTCATCCATCGCACTGCCACGCATATTTGCCGAATTGAATATTCCTAACGGATGCGGGGACACATCTATAAACCG
GTTTTGTCGCGCCCTCGCTAATAACAAAGAACCTGCAGCTAGTCTGGCACGATACATCAAAACGTGCAATTTTGC
TGCTTCCATGCCATGCGAAGGTTCGCTTCGAACTCAGGAAGCTTTCTTTTTCATGTACTGTGTCGCTCTCTCAAA
AATGACCTCTGCTGAGGCCATTAACCTAGATCGCGTAACCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail