Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028790
Gene name
Locationscaffold_12:194243..195038
Strand+
Gene length (bp)795
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1317 0.0688 0.7469 0.3234 0.0499 0.0043 0.4256 0.2013 0.2458 0.0079

SignalP

SignalP signal predicted Location Score
Yes 1 - 28 0.99967

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 4.20 1.46 6.95
Initials Initials knots 3.56 1.03 6.08
Pileal_Stipeal_center Stage I stipe center 2.35 0.61 4.10
Pileal_Stipeal_shell Stage I stipe shell 3.12 0.88 5.35
DIF_stipe_center Stage II stipe center 2.59 0.73 4.45
DIF_stipe_shell Stage II stipe shell 1.97 0.39 3.56
DIF_stipe_skin Stage II stipe skin 3.04 0.93 5.15
DIF_cap_skin Stage II cap skin 1.78 0.24 3.32
DIF_cap_tissue Stage II cap tissue 1.89 0.39 3.38
DIF_gill_tissue Stage II gill tissue 1.70 0.30 3.09
YFB_stipe_center Young fruiting body stipe center 1.36 0.21 2.51
YFB_stipe_shell Young fruiting body stipe shell 1.26 0.08 2.45
YFB_stipe_skin Young fruiting body stipe skin 3.25 1.02 5.48
YFB_cap_skin Young fruiting body cap skin 1.72 0.32 3.13
YFB_cap_tissue Young fruiting body cap tissue 1.24 0.17 2.31
YFB_gill_tissue Young fruiting body gill tissue 2.52 0.67 4.37
YFB_veil Young fruiting body veil 2.54 0.66 4.42

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.088613 no
Casing YFB_stipe_center 0.031800 yes
Casing YFB_stipe_shell 0.053765 no
Casing YFB_stipe_skin 0.700873 no
Casing YFB_cap_skin 0.101215 no
Casing YFB_cap_tissue 0.021846 yes
Casing YFB_gill_tissue 0.362895 no
Casing YFB_veil 0.378468 no
Casing Initials 0.831196 no
Casing Pileal_Stipeal_center 0.284552 no
Casing Pileal_Stipeal_shell 0.651673 no
Casing DIF_stipe_center 0.377603 no
Casing DIF_stipe_shell 0.149754 no
Casing DIF_stipe_skin 0.598817 no
Casing DIF_cap_skin 0.117324 no
Casing DIF_cap_tissue 0.131549 no
DIF_gill_tissue YFB_stipe_center 0.820475 no
DIF_gill_tissue YFB_stipe_shell 0.761615 no
DIF_gill_tissue YFB_stipe_skin 0.276237 no
DIF_gill_tissue YFB_cap_skin 0.991610 no
DIF_gill_tissue YFB_cap_tissue 0.711253 no
DIF_gill_tissue YFB_gill_tissue 0.594698 no
DIF_gill_tissue YFB_veil 0.589025 no
YFB_stipe_center YFB_stipe_shell 0.951641 no
YFB_stipe_center YFB_stipe_skin 0.116723 no
YFB_stipe_center YFB_cap_skin 0.801111 no
YFB_stipe_center YFB_cap_tissue 0.929180 no
YFB_stipe_center YFB_gill_tissue 0.332993 no
YFB_stipe_center YFB_veil 0.322879 no
YFB_stipe_shell YFB_stipe_skin 0.132135 no
YFB_stipe_shell YFB_cap_skin 0.750694 no
YFB_stipe_shell YFB_cap_tissue 0.988792 no
YFB_stipe_shell YFB_gill_tissue 0.329044 no
YFB_stipe_shell YFB_veil 0.312315 no
YFB_stipe_skin YFB_cap_skin 0.292131 no
YFB_stipe_skin YFB_cap_tissue 0.078057 no
YFB_stipe_skin YFB_gill_tissue 0.739006 no
YFB_stipe_skin YFB_veil 0.754290 no
YFB_cap_skin YFB_cap_tissue 0.694381 no
YFB_cap_skin YFB_gill_tissue 0.615754 no
YFB_cap_skin YFB_veil 0.604699 no
YFB_cap_tissue YFB_gill_tissue 0.248129 no
YFB_cap_tissue YFB_veil 0.235697 no
YFB_gill_tissue YFB_veil 0.993578 no
Initials DIF_gill_tissue 0.200802 no
Initials YFB_stipe_center 0.081583 no
Initials YFB_stipe_shell 0.100894 no
Initials YFB_stipe_skin 0.921438 no
Initials YFB_cap_skin 0.217538 no
Initials YFB_cap_tissue 0.055979 no
Initials YFB_gill_tissue 0.618905 no
Initials YFB_veil 0.637689 no
Initials Pileal_Stipeal_center 0.530896 no
Initials Pileal_Stipeal_shell 0.883160 no
Initials DIF_stipe_center 0.645490 no
Initials DIF_stipe_shell 0.322692 no
Initials DIF_stipe_skin 0.852231 no
Initials DIF_cap_skin 0.254850 no
Initials DIF_cap_tissue 0.291950 no
Pileal_Stipeal_center DIF_gill_tissue 0.680674 no
Pileal_Stipeal_center YFB_stipe_center 0.402915 no
Pileal_Stipeal_center YFB_stipe_shell 0.378960 no
Pileal_Stipeal_center YFB_stipe_skin 0.648298 no
Pileal_Stipeal_center YFB_cap_skin 0.700248 no
Pileal_Stipeal_center YFB_cap_tissue 0.303175 no
Pileal_Stipeal_center YFB_gill_tissue 0.947468 no
Pileal_Stipeal_center YFB_veil 0.938581 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.713092 no
Pileal_Stipeal_center DIF_stipe_center 0.920616 no
Pileal_Stipeal_center DIF_stipe_shell 0.844574 no
Pileal_Stipeal_center DIF_stipe_skin 0.733236 no
Pileal_Stipeal_center DIF_cap_skin 0.739564 no
Pileal_Stipeal_center DIF_cap_tissue 0.800183 no
Pileal_Stipeal_shell DIF_gill_tissue 0.325245 no
Pileal_Stipeal_shell YFB_stipe_center 0.144431 no
Pileal_Stipeal_shell YFB_stipe_shell 0.160518 no
Pileal_Stipeal_shell YFB_stipe_skin 0.967068 no
Pileal_Stipeal_shell YFB_cap_skin 0.345557 no
Pileal_Stipeal_shell YFB_cap_tissue 0.099434 no
Pileal_Stipeal_shell YFB_gill_tissue 0.794418 no
Pileal_Stipeal_shell YFB_veil 0.806837 no
Pileal_Stipeal_shell DIF_stipe_center 0.821306 no
Pileal_Stipeal_shell DIF_stipe_shell 0.487001 no
Pileal_Stipeal_shell DIF_stipe_skin 0.979318 no
Pileal_Stipeal_shell DIF_cap_skin 0.386494 no
Pileal_Stipeal_shell DIF_cap_tissue 0.441983 no
DIF_stipe_center DIF_gill_tissue 0.536992 no
DIF_stipe_center YFB_stipe_center 0.275058 no
DIF_stipe_center YFB_stipe_shell 0.275344 no
DIF_stipe_center YFB_stipe_skin 0.761074 no
DIF_stipe_center YFB_cap_skin 0.552303 no
DIF_stipe_center YFB_cap_tissue 0.198663 no
DIF_stipe_center YFB_gill_tissue 0.978058 no
DIF_stipe_center YFB_veil 0.985394 no
DIF_stipe_center DIF_stipe_shell 0.722221 no
DIF_stipe_center DIF_stipe_skin 0.842831 no
DIF_stipe_center DIF_cap_skin 0.599545 no
DIF_stipe_center DIF_cap_tissue 0.670534 no
DIF_stipe_shell DIF_gill_tissue 0.883112 no
DIF_stipe_shell YFB_stipe_center 0.634752 no
DIF_stipe_shell YFB_stipe_shell 0.584487 no
DIF_stipe_shell YFB_stipe_skin 0.421303 no
DIF_stipe_shell YFB_cap_skin 0.896705 no
DIF_stipe_shell YFB_cap_tissue 0.516893 no
DIF_stipe_shell YFB_gill_tissue 0.769060 no
DIF_stipe_shell YFB_veil 0.757680 no
DIF_stipe_shell DIF_stipe_skin 0.503895 no
DIF_stipe_shell DIF_cap_skin 0.925366 no
DIF_stipe_shell DIF_cap_tissue 0.968137 no
DIF_stipe_skin DIF_gill_tissue 0.333988 no
DIF_stipe_skin YFB_stipe_center 0.150844 no
DIF_stipe_skin YFB_stipe_shell 0.166855 no
DIF_stipe_skin YFB_stipe_skin 0.943913 no
DIF_stipe_skin YFB_cap_skin 0.353026 no
DIF_stipe_skin YFB_cap_tissue 0.105537 no
DIF_stipe_skin YFB_gill_tissue 0.816901 no
DIF_stipe_skin YFB_veil 0.830008 no
DIF_stipe_skin DIF_cap_skin 0.395275 no
DIF_stipe_skin DIF_cap_tissue 0.453095 no
DIF_cap_skin DIF_gill_tissue 0.967214 no
DIF_cap_skin YFB_stipe_center 0.766457 no
DIF_cap_skin YFB_stipe_shell 0.711602 no
DIF_cap_skin YFB_stipe_skin 0.330123 no
DIF_cap_skin YFB_cap_skin 0.975878 no
DIF_cap_skin YFB_cap_tissue 0.655094 no
DIF_cap_skin YFB_gill_tissue 0.657320 no
DIF_cap_skin YFB_veil 0.646489 no
DIF_cap_skin DIF_cap_tissue 0.960358 no
DIF_cap_tissue DIF_gill_tissue 0.920085 no
DIF_cap_tissue YFB_stipe_center 0.693284 no
DIF_cap_tissue YFB_stipe_shell 0.642300 no
DIF_cap_tissue YFB_stipe_skin 0.377268 no
DIF_cap_tissue YFB_cap_skin 0.932072 no
DIF_cap_tissue YFB_cap_tissue 0.578925 no
DIF_cap_tissue YFB_gill_tissue 0.714310 no
DIF_cap_tissue YFB_veil 0.707656 no

Orthologs

Orthofinder run ID1
Orthogroup7246
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|028790
Agaricus bisporus var bisporus H97 AgabiH97|028790 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|81_15

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028790
MAYYHLNKNYLSGVILLVILCHLSGALAALYPTQPVAKTVFATGSSALVTWKDDTHVPHVYDLGDLVIKLYTAQA
VYVATLALGVNPNSFGTQVTFPADLRNDTLYFLTFRGPGLQRDIYTANFAIVSDPTLVKASSTTLSAVPPVQSLL
ADGSMNSTAANMNLTSPGQQMFTSTTMLPVSTVAADQYGSPYRNNGAVHSRASQLEQAKFRLLFVVWPIMFGLSM
AF*
Coding >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Transcript >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Gene >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTAAGTCCTCCAGGAGCGTGCAGAGTCCGAAGTCTGACTGACTATGTGACTATATGCGCAGGTATACGTAGCGAC
CTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTACGGAACGATACTCT
CTAGTAAGCTATCTCGCTTGGGACGCCGTGCGCCAATCTGAGAATTTGTCGAGTTTCCTTACATTCCGCGGTCCT
GGACTTCAACGTGACATATATACGGCCAACTTCGCTATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACA
ACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTCGCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAAT
TTAACATCACCAGGACAACAAATGTTTACGAGCACTACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATAC
GGATCACCTTATAGAAACAATGGTGCAGTACACAGCCGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTG
TTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATGGCATTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail