Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028790
Gene name
Locationscaffold_12:194243..195038
Strand+
Gene length (bp)795
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028790
MAYYHLNKNYLSGVILLVILCHLSGALAALYPTQPVAKTVFATGSSALVTWKDDTHVPHVYDLGDLVIKLYTAQA
VYVATLALGVNPNSFGTQVTFPADLRNDTLYFLTFRGPGLQRDIYTANFAIVSDPTLVKASSTTLSAVPPVQSLL
ADGSMNSTAANMNLTSPGQQMFTSTTMLPVSTVAADQYGSPYRNNGAVHSRASQLEQAKFRLLFVVWPIMFGLSM
AF*
Coding >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Transcript >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTATACGTAGCGACCTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTA
CGGAACGATACTCTCTATTTCCTTACATTCCGCGGTCCTGGACTTCAACGTGACATATATACGGCCAACTTCGCT
ATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACAACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTC
GCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAATTTAACATCACCAGGACAACAAATGTTTACGAGCACT
ACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATACGGATCACCTTATAGAAACAATGGTGCAGTACACAGC
CGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTGTTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATG
GCATTTTAA
Gene >AgabiH97|028790
ATGGCTTACTACCACCTAAACAAAAACTATCTTTCGGGCGTTATCCTTCTGGTGATTCTATGCCATCTCTCTGGG
GCTCTTGCGGCGCTCTACCCAACACAGCCTGTGGCAAAAACGGTCTTTGCTACTGGAAGCTCTGCTCTTGTGACT
TGGAAGGACGATACTCATGTTCCCCATGTATATGATCTAGGCGATCTGGTGATCAAGTTGTATACAGCTCAAGCT
GTAAGTCCTCCAGGAGCGTGCAGAGTCCGAAGTCTGACTGACTATGTGACTATATGCGCAGGTATACGTAGCGAC
CTTGGCTCTGGGCGTAAATCCGAACTCGTTTGGAACTCAGGTGACGTTTCCGGCCGATTTACGGAACGATACTCT
CTAGTAAGCTATCTCGCTTGGGACGCCGTGCGCCAATCTGAGAATTTGTCGAGTTTCCTTACATTCCGCGGTCCT
GGACTTCAACGTGACATATATACGGCCAACTTCGCTATAGTTTCAGATCCCACCTTGGTTAAAGCGTCTTCAACA
ACGCTAAGCGCAGTTCCCCCGGTCCAATCCTTACTCGCTGATGGCTCGATGAATTCTACAGCGGCGAATATGAAT
TTAACATCACCAGGACAACAAATGTTTACGAGCACTACCATGCTACCGGTGTCGACTGTCGCCGCTGATCAATAC
GGATCACCTTATAGAAACAATGGTGCAGTACACAGCCGGGCTAGTCAACTGGAGCAGGCGAAATTCAGACTTTTG
TTCGTTGTCTGGCCGATCATGTTTGGATTGTCGATGGCATTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail