Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028730
Gene name
Locationscaffold_12:170630..173056
Strand+
Gene length (bp)2426
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.3E-41 72 464
PF00083 Sugar_tr Sugar (and other) transporter 3.1E-14 83 317
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.1E-06 86 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 32 509 3.0E-131
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 25 512 5.0E-71
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 28 513 7.0E-70
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 52 511 5.0E-66
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 34 511 8.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 32 509 3.0E-131
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 25 512 5.0E-71
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 28 513 7.0E-70
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 52 511 5.0E-66
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 34 511 8.0E-65
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 23 512 8.0E-65
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 34 511 1.0E-64
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 38 515 1.0E-64
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 26 512 2.0E-64
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 4 512 5.0E-62
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 41 514 7.0E-62
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 19 514 9.0E-62
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 12 514 3.0E-61
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 27 511 1.0E-60
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 39 512 2.0E-59
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 43 513 4.0E-59
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 43 513 4.0E-59
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 50 510 5.0E-59
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 12 512 5.0E-59
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 23 512 1.0E-57
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 36 514 1.0E-56
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 40 514 3.0E-56
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 9 517 6.0E-55
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 32 517 3.0E-53
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 8 512 6.0E-53
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 514 3.0E-36
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 25 509 1.0E-35
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 27 525 7.0E-34
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 364 511 9.0E-25
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 79 460 1.0E-20
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 31 475 1.0E-19
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 60 339 4.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 55 258 9.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 70 230 2.0E-14
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 71 272 2.0E-13
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 4 229 5.0E-13
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 77 256 6.0E-13
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 12 520 1.0E-11
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 57 225 4.0E-11
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 56 385 4.0E-11
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 121 225 8.0E-11
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 55 230 9.0E-11
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 70 408 1.0E-10
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 121 225 1.0E-10
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 60 248 3.0E-10
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 70 365 5.0E-10
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 8 225 5.0E-10
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 26 262 1.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 25 229 4.0E-09
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 109 245 8.0E-09
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 76 366 8.0E-09
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 109 245 8.0E-09
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 109 245 8.0E-09
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 109 245 9.0E-09
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 76 225 1.0E-08
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 76 225 1.0E-08
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 63 245 1.0E-08
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 63 245 1.0E-08
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 53 230 1.0E-08
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 109 245 1.0E-08
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 75 224 2.0E-08
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 109 245 2.0E-08
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 109 274 2.0E-08
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 109 274 2.0E-08
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 109 245 2.0E-08
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 109 245 2.0E-08
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 77 241 2.0E-08
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 109 274 3.0E-08
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 69 224 3.0E-08
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 123 241 3.0E-08
sp|P39398|LGOT_ECOLI Probable L-galactonate transporter OS=Escherichia coli (strain K12) GN=lgoT PE=1 SV=2 63 289 4.0E-08
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 109 274 4.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 215 497 5.0E-08
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 109 245 5.0E-08
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 109 274 5.0E-08
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 109 274 5.0E-08
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 123 225 6.0E-08
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 109 274 1.0E-07
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 80 236 1.0E-07
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 109 245 1.0E-07
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 109 245 1.0E-07
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 105 294 2.0E-07
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 47 275 2.0E-07
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 109 245 2.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 55 248 3.0E-07
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 109 274 3.0E-07
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 109 274 3.0E-07
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 109 274 3.0E-07
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 109 245 3.0E-07
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 109 245 4.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 71 225 4.0E-07
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 58 224 4.0E-07
sp|D5B5U5|MDFA_YERPZ Multidrug transporter MdfA OS=Yersinia pestis (strain Z176003) GN=mdfA PE=3 SV=2 73 240 5.0E-07
sp|A9R4E0|MDFA_YERPG Multidrug transporter MdfA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdfA PE=3 SV=2 73 240 5.0E-07
sp|D0JKF6|MDFA_YERPD Multidrug transporter MdfA OS=Yersinia pestis (strain D106004) GN=mdfA PE=3 SV=2 73 240 5.0E-07
sp|D0JUX5|MDFA_YERP1 Multidrug transporter MdfA OS=Yersinia pestis (strain D182038) GN=mdfA PE=3 SV=2 73 240 5.0E-07
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 100 245 6.0E-07
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 68 242 2.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 68 242 2.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 52 217 2.0E-06
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 142 224 2.0E-06
sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 63 233 3.0E-06
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 14 262 4.0E-06
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 122 245 4.0E-06
sp|Q68WD6|BCRH_RICTY Uncharacterized transporter RT0591 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0591 PE=3 SV=1 69 241 5.0E-06
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 76 242 8.0E-06
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 76 242 8.0E-06
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 109 246 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 124 22
3 137 154 17
4 158 180 22
5 193 215 22
6 230 252 22
7 308 330 22
8 340 362 22
9 383 405 22
10 410 430 20
11 443 465 22
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028730
MDPLSPTTSSPSSKRPTTTPTPTPNSEDTAREDKHEDSEPDIIVVDWDGPDDPANPKNWKYSKKWASTVIVSLFT
FISPVSSAMVAPATSQIVEEFGVHSSVVQAMMTSVFVLGYAFGPLFLGPMSEIWGRSHVLQLSNLFYLVWNLACG
FAQNKGQLIAFRLLAGIGGSAPLSIGGGVLSDVWRVEERGRASAIYSLAPLLGPVIGPICGGWIAMRSTWRWVFW
STSIIDVIVQLAGLYYLNESFAPYLLGKKAKKLRASLLERNERAKEVRTVYETKGSRQWKHIFRVALTRPFSLFA
FEPIIQLFGVYMALIYGVFYLFLTTIPQIFSSTYHQNVGIGGLHYIALGIGLSGASQLNARYMDRIYIWLRGRYG
NGVGRPEFRLPSMLPGTIAMPLGLLLTGWAAQNKLHWIVTDIGIAFVGMGVILNFQAMQIYILDSFTLHAASALA
AVSCLRSLAGFGFPLFAPSMYDTLGYGKGNTILACVAIVIGCPAPFVFWIYGEKIRHASRFARKSESQPRAQPLK
ETSAQSSDPDVEKAIVPSGGPDPEKTSTHSS*
Coding >AgabiH97|028730
ATGGATCCTTTATCTCCCACTACCTCTTCCCCAAGTTCGAAGCGACCAACTACAACTCCAACTCCAACTCCAAAC
TCTGAAGACACCGCCAGAGAGGATAAACATGAAGACTCAGAGCCTGATATAATTGTGGTTGATTGGGATGGGCCG
GATGATCCAGCGAATCCAAAAAATTGGAAGTACTCGAAAAAATGGGCTTCAACGGTCATTGTGTCGTTGTTCACC
TTCATATCGCCAGTATCGTCTGCAATGGTGGCTCCAGCCACCTCACAGATAGTGGAGGAATTCGGAGTTCATAGT
TCAGTCGTTCAGGCTATGATGACTTCGGTGTTTGTTCTGGGTTACGCATTCGGCCCTCTCTTTCTTGGGCCTATG
AGTGAGATATGGGGACGATCACATGTACTACAACTATCCAACCTTTTCTATCTCGTTTGGAATCTAGCTTGTGGT
TTCGCGCAAAACAAAGGGCAACTTATCGCGTTCCGTCTTTTGGCAGGTATAGGGGGAAGCGCACCGTTATCAATA
GGTGGTGGTGTACTTTCCGACGTATGGCGGGTGGAAGAGAGAGGTAGAGCAAGTGCGATATACTCGCTTGCTCCC
TTGTTGGGGCCCGTCATAGGACCCATCTGTGGTGGTTGGATAGCTATGCGATCAACTTGGAGATGGGTGTTTTGG
TCGACGAGTATTATCGACGTAATAGTTCAATTGGCTGGTCTCTATTACCTCAATGAATCCTTTGCACCATACCTT
CTTGGAAAGAAAGCGAAAAAGCTTCGGGCTAGTCTACTAGAACGAAATGAACGAGCGAAAGAGGTCCGGACGGTG
TATGAAACCAAAGGTAGTCGCCAGTGGAAACATATATTCCGTGTCGCTCTCACTCGGCCATTTTCTCTCTTTGCA
TTCGAGCCCATCATCCAACTATTCGGCGTCTACATGGCACTAATCTATGGAGTTTTTTATCTATTCTTGACCACG
ATCCCCCAGATTTTCTCTAGCACGTATCACCAGAACGTTGGAATTGGGGGCTTGCATTACATTGCACTTGGGATT
GGACTCTCTGGTGCATCCCAGTTGAACGCTCGCTACATGGATAGAATATATATCTGGCTTAGAGGACGCTATGGA
AACGGAGTTGGTCGACCAGAATTTCGATTGCCTTCAATGCTCCCAGGCACCATCGCTATGCCTTTAGGATTATTA
TTAACAGGATGGGCTGCTCAGAATAAGCTTCATTGGATCGTCACTGATATTGGCATCGCATTCGTCGGAATGGGT
GTAATCCTAAACTTCCAAGCAATGCAAATATACATTTTAGATTCTTTTACTCTCCATGCAGCGTCAGCACTGGCT
GCTGTATCATGCCTACGATCTCTAGCAGGTTTCGGCTTCCCTCTCTTTGCGCCGAGCATGTATGATACTTTGGGA
TATGGTAAAGGCAACACAATCCTCGCTTGCGTAGCAATCGTAATAGGGTGTCCTGCTCCATTCGTTTTCTGGATA
TATGGAGAGAAAATTAGGCACGCGAGTCGTTTTGCCCGGAAATCTGAATCACAACCTCGTGCACAGCCATTAAAA
GAAACTAGTGCACAATCCAGTGACCCTGACGTCGAAAAGGCCATCGTACCATCTGGTGGCCCCGACCCGGAAAAA
ACATCCACGCATTCATCTTAA
Transcript >AgabiH97|028730
ATGGATCCTTTATCTCCCACTACCTCTTCCCCAAGTTCGAAGCGACCAACTACAACTCCAACTCCAACTCCAAAC
TCTGAAGACACCGCCAGAGAGGATAAACATGAAGACTCAGAGCCTGATATAATTGTGGTTGATTGGGATGGGCCG
GATGATCCAGCGAATCCAAAAAATTGGAAGTACTCGAAAAAATGGGCTTCAACGGTCATTGTGTCGTTGTTCACC
TTCATATCGCCAGTATCGTCTGCAATGGTGGCTCCAGCCACCTCACAGATAGTGGAGGAATTCGGAGTTCATAGT
TCAGTCGTTCAGGCTATGATGACTTCGGTGTTTGTTCTGGGTTACGCATTCGGCCCTCTCTTTCTTGGGCCTATG
AGTGAGATATGGGGACGATCACATGTACTACAACTATCCAACCTTTTCTATCTCGTTTGGAATCTAGCTTGTGGT
TTCGCGCAAAACAAAGGGCAACTTATCGCGTTCCGTCTTTTGGCAGGTATAGGGGGAAGCGCACCGTTATCAATA
GGTGGTGGTGTACTTTCCGACGTATGGCGGGTGGAAGAGAGAGGTAGAGCAAGTGCGATATACTCGCTTGCTCCC
TTGTTGGGGCCCGTCATAGGACCCATCTGTGGTGGTTGGATAGCTATGCGATCAACTTGGAGATGGGTGTTTTGG
TCGACGAGTATTATCGACGTAATAGTTCAATTGGCTGGTCTCTATTACCTCAATGAATCCTTTGCACCATACCTT
CTTGGAAAGAAAGCGAAAAAGCTTCGGGCTAGTCTACTAGAACGAAATGAACGAGCGAAAGAGGTCCGGACGGTG
TATGAAACCAAAGGTAGTCGCCAGTGGAAACATATATTCCGTGTCGCTCTCACTCGGCCATTTTCTCTCTTTGCA
TTCGAGCCCATCATCCAACTATTCGGCGTCTACATGGCACTAATCTATGGAGTTTTTTATCTATTCTTGACCACG
ATCCCCCAGATTTTCTCTAGCACGTATCACCAGAACGTTGGAATTGGGGGCTTGCATTACATTGCACTTGGGATT
GGACTCTCTGGTGCATCCCAGTTGAACGCTCGCTACATGGATAGAATATATATCTGGCTTAGAGGACGCTATGGA
AACGGAGTTGGTCGACCAGAATTTCGATTGCCTTCAATGCTCCCAGGCACCATCGCTATGCCTTTAGGATTATTA
TTAACAGGATGGGCTGCTCAGAATAAGCTTCATTGGATCGTCACTGATATTGGCATCGCATTCGTCGGAATGGGT
GTAATCCTAAACTTCCAAGCAATGCAAATATACATTTTAGATTCTTTTACTCTCCATGCAGCGTCAGCACTGGCT
GCTGTATCATGCCTACGATCTCTAGCAGGTTTCGGCTTCCCTCTCTTTGCGCCGAGCATGTATGATACTTTGGGA
TATGGTAAAGGCAACACAATCCTCGCTTGCGTAGCAATCGTAATAGGGTGTCCTGCTCCATTCGTTTTCTGGATA
TATGGAGAGAAAATTAGGCACGCGAGTCGTTTTGCCCGGAAATCTGAATCACAACCTCGTGCACAGCCATTAAAA
GAAACTAGTGCACAATCCAGTGACCCTGACGTCGAAAAGGCCATCGTACCATCTGGTGGCCCCGACCCGGAAAAA
ACATCCACGCATTCATCTTAA
Gene >AgabiH97|028730
ATGGATCCTTTATCTCCCACTACCTCTTCCCCAAGTTCGAAGCGACCAACTACAACTCCAACTCCAACTCCAAAC
TCTGAAGACACCGCCAGAGAGGATAAACATGAAGACTCAGAGCCTGATATAATTGTGGTTGATTGGGATGGGCCG
GATGATCCAGCGAATCCAAAAAAGTGCGCCTTTTGAACTTGGATACATTCGGCGTTGTTGCTAATACTTTTCTTA
GTTGGAAGTACTCGAAAAAATGGGCTTCAACGGTCATTGTGTCGTTGTTCACCTTCATATCGCCAGTATCGTCTG
CAATGGTGGCTCCAGCCACCTCACAGATAGTGGAGGAATTCGGAGTTCATAGTTCAGTCGTTCAGGCTATGATGA
CTTCGGTGTTTGTTCTGGGTTACGGTGCGTGCGAGGTTGCCATCTACCGCGAGGTTCTCTATTCAGCTAACTTAT
AACTGTATGAAGCATTCGGCCCTCTCGTACGTTTTGAACCATTCTGCCCTGGTCACGCATACTAATTTCCTTCAG
TTTCTTGGGCCTATGAGTGAGATATGGGGACGATCACATGTACTACAACTATCCAACCTTTTCTATCTCGGTACG
AATTCACTGCTCTACTAGTCCTCCAACCCTTAGGTTTGATTGCGTTTTCGTTTATAGTTTGGAATCTAGCTTGTG
GTTTCGCGCAAAACAAAGGGCAACTTATCGCGTTCCGTCTTTTGGCAGGTATAGGGGGAAGCGCACCGTTATCAG
TAAGGTTTCTCTTCCATTTCCAGCCGACTCTCCTTAAACACAAATATCAGATAGGTGGTGGTGTACTTTCCGACG
TATGGCGGGTGGAAGAGAGAGGTAGAGCAAGTGCGATATACTCGCTTGCTCCCTTGTTGGGGCCCGTCATAGGAC
CCATCTGTGGTGGTTGGTAAGTTTTGATTTGGCTTCAGTACCGGATTCATGTCTGATTGACTTATAGGATAGCTA
TGCGATCAACTTGGAGATGGGTGGTATGTACTCCGAGCATTCAAATTGGATCACTGTTCTTTATCTAAGAGGTAT
CTTTTTTAGTTTTGGTCGACGAGTATTATCGACGTAATAGTTCAATTGGCTGGTCTCTATTACCTCAATGAATGT
AAGTATTTCACCCTTTGCATCGGCCTTTACTTTTGTTGATTGCTGAGGTAGCCTTTGCACCATACCTTCTTGGAA
AGAAAGCGAAAAAGCTTCGGGCTAGTCTACTAGAACGAAATGAACGAGCGAAAGAGGTCCGGACGGTGTATGAAA
CCAAAGGTAGTCGCCAGTAAGCGGTCATATATGCACTGTTGAGGTCAATGAAAATAATCATTATTCTAGGTGGAA
ACATATATTCCGTGTCGCTCTCACTCGGCCATTTTCTCTCTTTGCATTCGAGCCCATCATCCAACTATTCGGCGT
CTACATGGCACTAATCTATGGAGTTTTTTATCGTGCGCTATTTTCCAATAAATTGCGACGCAAATCTAATTAATG
ACTTAGTATTCTTGACCACGATCCCCCAGATTTTCTCTAGCACGTATCACCAGAACGTTGGAATTGGGGGCTTGC
ATTACATTGCACTTGGGATTGGACTCTCTGGTGCATCCCAGGTAGGAGTTGATTCTTACAGAGATAGCTACAGAT
ATTAACCCATCCTAGTTGAACGCTCGCTACATGGATAGAATATATATCTGGCTTAGAGGACGCTATGGAAACGGA
GTTGGTCGACCAGAATTTCGATTGCGTGAGCTCTACGCCACAAATCATTTTTCGTTAACTCAACTGATGGCTGAA
AAACAGCTTCAATGCTCCCAGGCACCATCGCTATGCCTTTAGGATTATTATTAACAGGATGGGCTGCTCAGAATA
AGCTTCATTGGATCGTCACTGATATTGTGGGTATTAAGACAGCACCATTTAGTAACAATCTAACGATTACAGGGC
ATCGCATTCGTCGGAATGGGTGTAATCCTAAACTTCCAAGCAATGCAAATATACATTTTAGATTCTTTTACTCTC
CATGCAGCGTCAGCACTGGCTGCTGTATCATGCCTACGATCTCTAGCAGGTTTCGGCTTCCCTCTCTTTGCGCCG
AGCATGTATGATACTTTGGGATATGGTAAAGGCAACACAATCCTCGCTTGCGTAGCAATCGTAATAGGGTGTCCT
GCGTAAGTCAATTCGAGAGTATCTCGTGCACAACCCGTTCTTAATCATTTGTCATTTTCAGTCCATTCGTTTTCT
GGATATATGGAGAGAAAATTAGGCACGCGAGTCGTTTTGCCCGGAAATCTGAATCACAACCTCGTGCACAGCCAT
TAAAAGAAACTAGTGCACAATCCAGTGACCCTGACGTCGAAAAGGCCATCGTACCATCTGGTGGCCCCGACCCGG
AAAAAACATCCACGCATTCATCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail