Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028380
Gene name
Locationscaffold_12:61502..64019
Strand-
Gene length (bp)2517
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 9.4E-80 149 548
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-10 113 539

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 24 586 3.0E-132
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 15 586 6.0E-126
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 14 578 4.0E-84
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 73 553 1.0E-33
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 116 525 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 24 586 3.0E-132
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 15 586 6.0E-126
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 14 578 4.0E-84
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 73 553 1.0E-33
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 116 525 1.0E-31
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 69 585 1.0E-31
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 69 585 9.0E-31
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 169 585 1.0E-30
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 127 545 5.0E-30
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 73 545 3.0E-29
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 63 465 3.0E-28
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 63 465 2.0E-27
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 63 465 3.0E-27
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 73 547 3.0E-27
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 63 465 8.0E-27
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 63 442 1.0E-24
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 59 457 2.0E-24
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 63 465 3.0E-24
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 69 457 4.0E-24
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 127 545 5.0E-24
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 63 442 2.0E-23
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 73 547 3.0E-22
sp|Q9M1I2|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4 OS=Arabidopsis thaliana GN=NPF5.4 PE=2 SV=1 64 544 5.0E-22
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 132 549 7.0E-22
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 236 549 8.0E-22
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 236 549 3.0E-21
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 63 465 6.0E-21
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 30 488 6.0E-20
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 38 465 4.0E-17
sp|Q9M331|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7 OS=Arabidopsis thaliana GN=NPF5.7 PE=2 SV=2 35 546 1.0E-16
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 132 548 1.0E-16
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 50 463 4.0E-16
sp|Q9LVE0|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana GN=NPF6.4 PE=1 SV=1 142 545 1.0E-15
sp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1 132 523 3.0E-15
sp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1 34 523 4.0E-15
sp|Q8RX77|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13 OS=Arabidopsis thaliana GN=NPF2.13 PE=1 SV=1 115 545 3.0E-14
sp|Q9SK99|PTR11_ARATH Protein NRT1/ PTR FAMILY 5.15 OS=Arabidopsis thaliana GN=NPF5.15 PE=2 SV=1 44 545 4.0E-14
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 65 545 2.0E-12
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 117 545 2.0E-12
sp|P0CI03|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6 OS=Arabidopsis thaliana GN=NPF5.6 PE=2 SV=1 52 544 3.0E-12
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 66 529 6.0E-12
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 48 526 7.0E-12
sp|Q9SRI2|PTR31_ARATH Protein NRT1/ PTR FAMILY 5.9 OS=Arabidopsis thaliana GN=NPF5.9 PE=2 SV=1 117 545 7.0E-12
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 28 529 3.0E-11
sp|Q9FM20|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2 113 538 4.0E-11
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 139 557 4.0E-11
sp|Q8VZR7|PTR30_ARATH Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2 66 597 5.0E-11
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 73 545 7.0E-10
sp|Q8GXN2|PTR47_ARATH Protein NRT1/ PTR FAMILY 7.2 OS=Arabidopsis thaliana GN=NPF7.2 PE=2 SV=2 115 553 1.0E-09
sp|Q9SK96|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana GN=NPF5.16 PE=2 SV=1 10 536 2.0E-09
sp|Q8VYE4|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1 143 526 3.0E-09
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 65 548 1.0E-08
sp|Q05085|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3 OS=Arabidopsis thaliana GN=NPF6.3 PE=1 SV=1 111 545 2.0E-08
sp|Q9LFX9|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12 OS=Arabidopsis thaliana GN=NPF2.12 PE=1 SV=2 127 544 3.0E-07
sp|Q9SX20|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1 OS=Arabidopsis thaliana GN=NPF3.1 PE=2 SV=1 118 545 9.0E-07
sp|Q56XQ6|PTR15_ARATH Protein NRT1/ PTR FAMILY 4.4 OS=Arabidopsis thaliana GN=NPF4.4 PE=2 SV=1 143 524 2.0E-06
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 482 538 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 119 141 22
2 153 175 22
3 180 202 22
4 240 259 19
5 263 285 22
6 367 389 22
7 409 426 17
8 439 461 22
9 487 509 22
10 522 541 19
11 551 573 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028380
MAAVADGPVLDLAEKHPEVVDDKVNARDEVSSEVDEVDDVHAGLEFPTEEERLTLRRVADALPWTAYLIAFVELA
ERFSFYGSQVVFTNFIQQPLPPGSHTGAAGLIGQAGALGLGQKAATGLNTFYQFWCYITPLYGAYIADTRWGRYK
TICIAVGIALVGHIILIIAALPGVIEKKSAVGAFVVGMIVTGLGTGFFKSNISPLIAEQYKRTKIFVITTRHGER
VIVDPSLTVSRMYMYFYLFINIGAVIGQISMTYAEKFVGFYLAFTLPTVVFLLCPFVLYFGRHRYNRTPPTGSVF
STALRLWKLAARGRWSLNPMQTLRNMRADDFWENVKPSNIKVEDRPKWMNFDDLWVDEVRRGFKACAVFLWIPLY
WLTYNQINSNLLSQAATMNTHGLPNDILSNIDPIAIIIIIPICDLLVYPGLRRLGINFSALKKITGGFFTGALAM
TWAAVLQHFIYKTNPCHYSAATCKDAEGNAIVSPLNVWLQTGAYFLIAVSEIFASITGLEYAFTKAPTNMRSLVM
SAFLFTSAIASAIGEAFVSLSTDPLLVWNYGSMAVIAAIAGALFWLSVRRLDRDEDKLNNLGSGHMEPVRRDKEM
*
Coding >AgabiH97|028380
ATGGCTGCCGTCGCTGATGGCCCCGTCCTCGACCTTGCTGAAAAGCATCCTGAGGTTGTAGATGATAAAGTTAAC
GCGAGGGATGAGGTCTCCAGTGAAGTCGACGAGGTGGATGACGTCCATGCGGGACTCGAATTCCCCACCGAAGAA
GAACGGCTGACCCTTCGCCGTGTTGCGGACGCATTACCCTGGACCGCATACTTGATTGCGTTTGTGGAACTTGCC
GAGAGATTTTCATTTTATGGCTCCCAAGTCGTTTTCACCAACTTCATTCAACAACCACTCCCGCCTGGCTCTCAC
ACAGGTGCAGCCGGTCTCATAGGCCAGGCTGGTGCCTTGGGCTTGGGGCAAAAGGCCGCAACGGGTCTCAACACT
TTCTATCAATTTTGGTGTTATATTACTCCTCTCTATGGGGCCTATATCGCGGACACTCGCTGGGGACGGTACAAG
ACTATTTGTATTGCTGTGGGGATCGCTCTCGTTGGACATATCATCTTGATCATTGCTGCTCTACCCGGTGTCATC
GAGAAAAAGAGCGCTGTCGGCGCGTTTGTTGTGGGAATGATAGTAACTGGTCTCGGCACGGGCTTTTTCAAGTCA
AACATCTCTCCATTAATTGCTGAGCAGTACAAGCGGACTAAAATCTTCGTTATCACTACTCGACACGGCGAAAGA
GTGATCGTCGATCCATCTTTGACGGTTTCTCGCATGTACATGTATTTCTACCTGTTCATCAACATTGGGGCAGTC
ATTGGTCAAATTTCTATGACTTACGCTGAGAAATTCGTCGGCTTCTACCTTGCTTTCACCTTGCCCACTGTTGTC
TTCCTATTATGTCCATTTGTTCTTTACTTCGGACGACACCGCTACAACCGAACTCCTCCCACTGGTTCCGTGTTT
TCCACAGCGTTACGGTTATGGAAGCTTGCCGCTCGAGGGAGGTGGAGTCTCAATCCTATGCAAACATTACGAAAC
ATGCGGGCAGATGACTTCTGGGAGAATGTGAAACCCAGTAATATAAAGGTAGAGGATAGACCCAAATGGATGAAC
TTTGACGACCTGTGGGTTGATGAAGTACGAAGAGGATTCAAAGCCTGTGCTGTCTTCTTATGGATTCCGCTCTAC
TGGCTTACATACAACCAAATTAACAGCAACCTGTTATCCCAGGCCGCTACTATGAACACTCACGGATTACCTAAC
GATATTTTGTCAAACATCGATCCTATCGCTATTATCATCATTATTCCCATCTGTGACTTGCTTGTGTATCCGGGT
CTACGAAGATTAGGAATCAACTTCAGTGCGCTGAAGAAGATTACCGGTGGTTTCTTCACAGGGGCATTGGCAATG
ACTTGGGCAGCCGTTCTCCAACATTTCATCTACAAGACCAATCCTTGTCATTATTCAGCTGCGACTTGTAAAGAT
GCGGAAGGAAACGCCATTGTATCGCCTCTCAACGTCTGGCTCCAAACTGGAGCCTACTTCCTGATCGCCGTGAGC
GAAATCTTTGCTTCTATCACGGGTTTGGAGTATGCTTTCACGAAAGCACCCACGAATATGCGGTCTTTGGTCATG
TCCGCGTTCTTGTTCACATCTGCGATTGCCTCGGCTATCGGTGAAGCCTTCGTTTCCTTGTCAACGGATCCCTTG
TTGGTTTGGAATTATGGTTCGATGGCGGTTATAGCTGCGATTGCTGGTGCGCTCTTCTGGCTCTCGGTTAGAAGA
TTGGATAGGGATGAAGACAAACTTAATAATTTGGGATCGGGACACATGGAACCGGTTCGGAGAGACAAGGAGATG
TAA
Transcript >AgabiH97|028380
ATGGCTGCCGTCGCTGATGGCCCCGTCCTCGACCTTGCTGAAAAGCATCCTGAGGTTGTAGATGATAAAGTTAAC
GCGAGGGATGAGGTCTCCAGTGAAGTCGACGAGGTGGATGACGTCCATGCGGGACTCGAATTCCCCACCGAAGAA
GAACGGCTGACCCTTCGCCGTGTTGCGGACGCATTACCCTGGACCGCATACTTGATTGCGTTTGTGGAACTTGCC
GAGAGATTTTCATTTTATGGCTCCCAAGTCGTTTTCACCAACTTCATTCAACAACCACTCCCGCCTGGCTCTCAC
ACAGGTGCAGCCGGTCTCATAGGCCAGGCTGGTGCCTTGGGCTTGGGGCAAAAGGCCGCAACGGGTCTCAACACT
TTCTATCAATTTTGGTGTTATATTACTCCTCTCTATGGGGCCTATATCGCGGACACTCGCTGGGGACGGTACAAG
ACTATTTGTATTGCTGTGGGGATCGCTCTCGTTGGACATATCATCTTGATCATTGCTGCTCTACCCGGTGTCATC
GAGAAAAAGAGCGCTGTCGGCGCGTTTGTTGTGGGAATGATAGTAACTGGTCTCGGCACGGGCTTTTTCAAGTCA
AACATCTCTCCATTAATTGCTGAGCAGTACAAGCGGACTAAAATCTTCGTTATCACTACTCGACACGGCGAAAGA
GTGATCGTCGATCCATCTTTGACGGTTTCTCGCATGTACATGTATTTCTACCTGTTCATCAACATTGGGGCAGTC
ATTGGTCAAATTTCTATGACTTACGCTGAGAAATTCGTCGGCTTCTACCTTGCTTTCACCTTGCCCACTGTTGTC
TTCCTATTATGTCCATTTGTTCTTTACTTCGGACGACACCGCTACAACCGAACTCCTCCCACTGGTTCCGTGTTT
TCCACAGCGTTACGGTTATGGAAGCTTGCCGCTCGAGGGAGGTGGAGTCTCAATCCTATGCAAACATTACGAAAC
ATGCGGGCAGATGACTTCTGGGAGAATGTGAAACCCAGTAATATAAAGGTAGAGGATAGACCCAAATGGATGAAC
TTTGACGACCTGTGGGTTGATGAAGTACGAAGAGGATTCAAAGCCTGTGCTGTCTTCTTATGGATTCCGCTCTAC
TGGCTTACATACAACCAAATTAACAGCAACCTGTTATCCCAGGCCGCTACTATGAACACTCACGGATTACCTAAC
GATATTTTGTCAAACATCGATCCTATCGCTATTATCATCATTATTCCCATCTGTGACTTGCTTGTGTATCCGGGT
CTACGAAGATTAGGAATCAACTTCAGTGCGCTGAAGAAGATTACCGGTGGTTTCTTCACAGGGGCATTGGCAATG
ACTTGGGCAGCCGTTCTCCAACATTTCATCTACAAGACCAATCCTTGTCATTATTCAGCTGCGACTTGTAAAGAT
GCGGAAGGAAACGCCATTGTATCGCCTCTCAACGTCTGGCTCCAAACTGGAGCCTACTTCCTGATCGCCGTGAGC
GAAATCTTTGCTTCTATCACGGGTTTGGAGTATGCTTTCACGAAAGCACCCACGAATATGCGGTCTTTGGTCATG
TCCGCGTTCTTGTTCACATCTGCGATTGCCTCGGCTATCGGTGAAGCCTTCGTTTCCTTGTCAACGGATCCCTTG
TTGGTTTGGAATTATGGTTCGATGGCGGTTATAGCTGCGATTGCTGGTGCGCTCTTCTGGCTCTCGGTTAGAAGA
TTGGATAGGGATGAAGACAAACTTAATAATTTGGGATCGGGACACATGGAACCGGTTCGGAGAGACAAGGAGATG
TAA
Gene >AgabiH97|028380
ATGGCTGCCGTCGCTGATGGCCCCGTCCTCGACCTTGCTGAAAAGCATCCTGAGGTTGTAGATGATAAAGTTAAC
GCGAGGGATGAGGTCTCCAGTGAAGTCGACGAGGTGGATGACGTCCATGCGGGACTCGAATTCCCCACCGAAGAA
GAACGGCTGACCCTTCGCCGTGTTGCGGACGCATTACCCTGGACCGCATACTGTACGCCCTACAAATTTCTCTAT
ATTTCGAGTCACTAATGGAAACGTGCCGCCAGTGATTGCGTTTGTGGAACTTGCCGAGAGATTTTCAGTGAGTTG
GGTTCGGTCTAATGTGTCATGCCTGTGAAACTGATTCAAAAATCCACAGTTTTATGGCTCCCAAGTCGTTTTCGT
ACGTGCCACACTACTGTCCTATAAAACCAATTCACGAATATCTATTAGACCAACTTCATTCAACAACCACTCCCG
CCTGGCTCTCACACAGGTGCAGCCGGTCTCATAGGCCAGGCTGGTGCCTTGGGCTTGGGGCAAAAGGCCGCAACG
GGTCTCAACACTTTCTATCAATTTTGGTTCGTTACTGAACGTGTCCTCAACGCCATTTACTGATACTCTCCAAGG
TGTTATATTACTCCTCTCTATGGGGCCTATATCGCGGACACTCGCTGGGGACGGTACAAGACTATTTGTATTGCT
GTGGGGATCGCTCTCGTTGGACATATCATCTTGATCATTGCTGCTCTACCCGGTGTCATCGAGAAAAAGAGCGCT
GTCGGCGCGTTTGTTGTGGGAATGATAGTAACTGGTCTCGGTACGTTGCCCACTTCGAGCTTTCTTTTTTTTTGC
ATGTTTGCTTATGGTATACAGGCACGGGCTTTTTCAAGTCAAACATCTCTCCATTAATTGCTGAGCAGTACAAGC
GGACTAAAATCTTCGTTATCACTACTCGACACGGCGAAAGAGTGATCGTCGATCCATCTTTGACGGTTTCTCGCA
TGTACATGGTGAGTTAATCGTTCTTGTCGCTCCTTTACGAGATTGTTGACCACCCCCGATCTTCAGTATTTCTAC
CTGTTCATCAACATTGGGGCAGTCATTGGTCAAATTTCTATGACTTACGCTGAGAAAGTGCGTCCTTTTTTGAAG
TATATCATGATTATGGTCCTCACAAAGCTCTCAGTTCGTCGGCTTCTACCTTGCTTTCACCTTGCCCACTGTTGT
CTTCCTATTATGTCCATTTGTTCTTTACTTCGGACGACACCGCTACAACCGAACTCCTCCCACTGGTTCCGTGTT
TTCCACAGCGTTACGGTTATGGAAGCTTGCCGCTCGAGGGAGGTGGAGTCTCAATCCTATGCAAACATTACGAAA
CATGCGGGCAGATGACTTCTGGGAGAATGTGAAACCCAGTAATATAAAGGTAGAGGATAGACCCAAATGGATGAA
CTTTGACGACCTGTGGGTTGATGAAGTACGAAGAGGATTCAAAGCCTGTGCTGTCTTCTTATGGATTCCGCTCTA
CTGTATGTGGTTTTTCAACTGTGCTTTCGATGTACGGCGGCGACTCACTCCGATTTATTCAACCAGGGCTTACAT
ACAACCAAATTAACAGCAACCTGTTATCCCAGGCCGCTACTATGAACACTCACGGATTACCTAACGATATTTTGT
CAAACATCGATCCTATCGCTATTATCATCATTATTCCCATCTGTGACTTGCTTGTTAGTGTCCCTCAAACCATAT
ACGAACCATACTTACTGAGATCTACTTCAGGTGTATCCGGGTCTACGAAGATTAGGAATCAACTTCAGTGCGCTG
AAGAAGATTACCGGTGGTTTCTTCACAGGGGCATTGGCAATGACTTGGGCAGCCGGTCCGTTCCCATGCTTCTTT
ATTATGTTTTATTATTGGCTGACGAGTTTCTTTTTCCAGTTCTCCAACATTTCATCTACAAGGTATGTCCGCTTC
TTGGAAGCTTGCTGATGAGAAAGCTAACTCCCTTCATAGACCAATCCTTGTCATTATTCAGCTGCGACTTGTAAA
GATGCGGAAGGAAACGCCATTGTATCGCCTCTCAACGTCTGGCTCCAAACTGGAGCGTGAGTACTTCTAGTTTTA
AACCGTTTTCACATCTGACATAACTACTACAATAGCTACTTCCTGATCGCCGTGAGCGAAATCTTTGCTTCTATC
ACGGGTTTGGAGTATGCTTTCACGAAAGCACCCACGAATATGCGGTCTTTGGTCATGTCCGCGTTCTTGTTCACA
TCTGCGATTGCCTCGGCTATCGGTGAAGCCTTCGTTTGTGAGTTATTTTCGTTCGCATCACAAAAACCCGTCATT
AATCACGTATATAAATAAGCCTTGTCAACGGATCCCTTGTTGGTTTGGAATTATGGTTCGATGGCGGTTATAGCT
GCGATTGCTGGTGCGCTCTTCTGGCTCTCGGTTAGAAGATTGGATAGGGATGAAGACAAACTTAATAATTTGGGA
TCGGGACACATGGAACCGGTTCGGAGAGACAAGGAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail