Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028280
Gene name
Locationscaffold_12:43849..45767
Strand+
Gene length (bp)1918
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00246 Peptidase_M14 Zinc carboxypeptidase 6.7E-68 134 439

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5JZS0|ECM14_AJEDS Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain SLH14081) GN=ECM14 PE=3 SV=1 41 452 2.0E-59
sp|C5G6U8|ECM14_AJEDR Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=ECM14 PE=3 SV=1 41 452 3.0E-59
sp|B6H233|ECM14_PENRW Putative metallocarboxypeptidase ecm14 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=ecm14 PE=3 SV=1 39 453 9.0E-59
sp|A6RCF5|ECM14_AJECN Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ECM14 PE=3 SV=1 34 455 1.0E-58
sp|A2QZA2|ECM14_ASPNC Putative metallocarboxypeptidase ecm14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ecm14 PE=3 SV=1 39 452 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5JZS0|ECM14_AJEDS Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain SLH14081) GN=ECM14 PE=3 SV=1 41 452 2.0E-59
sp|C5G6U8|ECM14_AJEDR Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=ECM14 PE=3 SV=1 41 452 3.0E-59
sp|B6H233|ECM14_PENRW Putative metallocarboxypeptidase ecm14 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=ecm14 PE=3 SV=1 39 453 9.0E-59
sp|A6RCF5|ECM14_AJECN Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ECM14 PE=3 SV=1 34 455 1.0E-58
sp|A2QZA2|ECM14_ASPNC Putative metallocarboxypeptidase ecm14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ecm14 PE=3 SV=1 39 452 2.0E-58
sp|C6H4F1|ECM14_AJECH Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain H143) GN=ECM14 PE=3 SV=1 34 452 1.0E-57
sp|A7EUC0|ECM14_SCLS1 Putative metallocarboxypeptidase ecm14 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ecm14 PE=3 SV=1 120 452 6.0E-57
sp|E9DD69|ECM14_COCPS Putative metallocarboxypeptidase ECM14 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=ECM14 PE=3 SV=1 128 453 2.0E-56
sp|C0SAI5|ECM14_PARBP Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides brasiliensis (strain Pb03) GN=ECM14 PE=3 SV=1 41 452 2.0E-56
sp|C4JEE1|ECM14_UNCRE Putative metallocarboxypeptidase ECM14 OS=Uncinocarpus reesii (strain UAMH 1704) GN=ECM14 PE=3 SV=1 115 453 3.0E-56
sp|C1GDH9|ECM14_PARBD Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides brasiliensis (strain Pb18) GN=ECM14 PE=3 SV=1 41 452 3.0E-56
sp|C5PHW9|ECM14_COCP7 Putative metallocarboxypeptidase ECM14 OS=Coccidioides posadasii (strain C735) GN=ECM14 PE=3 SV=1 128 453 4.0E-56
sp|C1HE31|ECM14_PARBA Putative metallocarboxypeptidase ECM14 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=ECM14 PE=3 SV=1 41 452 9.0E-56
sp|C0NM08|ECM14_AJECG Putative metallocarboxypeptidase ECM14 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=ECM14 PE=3 SV=1 41 452 1.0E-55
sp|P04069|CBPB_ASTAS Carboxypeptidase B OS=Astacus astacus PE=1 SV=1 127 450 2.0E-55
sp|D4B5N0|MCPAL_ARTBC Metallocarboxypeptidase A-like protein ARB_03789 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03789 PE=3 SV=1 120 439 3.0E-55
sp|D4D675|MCPAL_TRIVH Metallocarboxypeptidase A-like protein TRV_02598 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02598 PE=3 SV=1 69 439 5.0E-55
sp|Q0C9B4|ECM14_ASPTN Putative metallocarboxypeptidase ecm14 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ecm14 PE=3 SV=1 39 452 9.0E-55
sp|Q2TZK2|ECM14_ASPOR Putative metallocarboxypeptidase ecm14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ecm14 PE=3 SV=1 124 450 2.0E-54
sp|B8NBP9|ECM14_ASPFN Putative metallocarboxypeptidase ecm14 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ecm14 PE=3 SV=1 124 450 3.0E-54
sp|B8M2K0|ECM14_TALSN Putative metallocarboxypeptidase ecm14 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=ecm14 PE=3 SV=1 128 453 3.0E-54
sp|B6Q972|ECM14_TALMQ Putative metallocarboxypeptidase ecm14 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=ecm14 PE=3 SV=1 124 453 7.0E-54
sp|P38836|ECM14_YEAST Putative metallocarboxypeptidase ECM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM14 PE=1 SV=1 63 450 1.0E-53
sp|P48052|CBPA2_HUMAN Carboxypeptidase A2 OS=Homo sapiens GN=CPA2 PE=1 SV=3 126 439 3.0E-53
sp|C5FH26|MCPAL_ARTOC Metallocarboxypeptidase A-like protein MCYG_01475 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01475 PE=3 SV=1 120 439 5.0E-53
sp|E4UPZ6|ECM14_ARTGP Putative metallocarboxypeptidase ECM14 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=ECM14 PE=3 SV=1 128 450 9.0E-53
sp|Q7TPZ8|CBPA1_MOUSE Carboxypeptidase A1 OS=Mus musculus GN=Cpa1 PE=1 SV=1 125 439 1.0E-52
sp|A1CSU3|ECM14_ASPCL Putative metallocarboxypeptidase ecm14 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ecm14 PE=3 SV=1 128 452 2.0E-52
sp|A1DGH9|ECM14_NEOFI Putative metallocarboxypeptidase ecm14 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ecm14 PE=3 SV=1 128 452 3.0E-52
sp|D4AKU7|ECM14_ARTBC Putative metallocarboxypeptidase ECM14 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ECM14 PE=3 SV=1 128 450 3.0E-52
sp|D4DIW7|ECM14_TRIVH Putative metallocarboxypeptidase ECM14 OS=Trichophyton verrucosum (strain HKI 0517) GN=ECM14 PE=3 SV=1 128 450 5.0E-52
sp|Q4X1U0|ECM14_ASPFU Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm14 PE=3 SV=1 128 458 6.0E-52
sp|B0XRS8|ECM14_ASPFC Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ecm14 PE=3 SV=1 128 458 6.0E-52
sp|C5FPR9|ECM14_ARTOC Putative metallocarboxypeptidase ECM14 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=ECM14 PE=3 SV=1 128 450 7.0E-52
sp|E5A0U8|ECM14_LEPMJ Putative metallocarboxypeptidase ECM14 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=ECM14 PE=3 SV=1 122 454 9.0E-52
sp|P19222|CBPA2_RAT Carboxypeptidase A2 OS=Rattus norvegicus GN=Cpa2 PE=1 SV=1 128 439 9.0E-52
sp|P00731|CBPA1_RAT Carboxypeptidase A1 OS=Rattus norvegicus GN=Cpa1 PE=2 SV=2 125 439 2.0E-51
sp|Q504N0|CBPA2_MOUSE Carboxypeptidase A2 OS=Mus musculus GN=Cpa2 PE=1 SV=1 126 439 2.0E-51
sp|Q9UI42|CBPA4_HUMAN Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2 125 439 7.0E-51
sp|P00730|CBPA1_BOVIN Carboxypeptidase A1 OS=Bos taurus GN=CPA1 PE=1 SV=3 125 439 1.0E-50
sp|Q8N4T0|CBPA6_HUMAN Carboxypeptidase A6 OS=Homo sapiens GN=CPA6 PE=1 SV=2 24 447 2.0E-50
sp|P19223|CBPB1_RAT Carboxypeptidase B OS=Rattus norvegicus GN=Cpb1 PE=1 SV=1 44 450 2.0E-50
sp|Q6P8K8|CBPA4_MOUSE Carboxypeptidase A4 OS=Mus musculus GN=Cpa4 PE=2 SV=2 125 439 3.0E-50
sp|O74818|YBJ7_SCHPO Uncharacterized carboxypeptidase C337.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.07c PE=3 SV=1 22 450 4.0E-50
sp|Q0II73|CBPO_BOVIN Carboxypeptidase O OS=Bos taurus GN=CPO PE=2 SV=1 128 443 3.0E-49
sp|Q5U901|CBPA6_MOUSE Carboxypeptidase A6 OS=Mus musculus GN=Cpa6 PE=2 SV=1 120 447 4.0E-49
sp|Q8IVL8|CBPO_HUMAN Carboxypeptidase O OS=Homo sapiens GN=CPO PE=2 SV=1 114 443 5.0E-49
sp|Q8R4H4|CBPA5_MOUSE Carboxypeptidase A5 OS=Mus musculus GN=Cpa5 PE=2 SV=1 115 448 6.0E-49
sp|Q5B011|ECM14_EMENI Putative metallocarboxypeptidase ecm14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ecm14 PE=3 SV=2 128 450 8.0E-49
sp|P42788|CBPZ_SIMVI Zinc carboxypeptidase (Fragment) OS=Simulium vittatum PE=2 SV=1 128 443 6.0E-48
sp|D4AS12|MCPA_ARTBC Probable metallocarboxypeptidase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MCPA PE=1 SV=2 54 452 2.0E-47
sp|D4DL57|MCPA_TRIVH Probable metallocarboxypeptidase A OS=Trichophyton verrucosum (strain HKI 0517) GN=MCPA PE=3 SV=1 54 452 2.0E-47
sp|A6XGK3|MCPA_TRIRU Metallocarboxypeptidase A OS=Trichophyton rubrum GN=MCPA PE=1 SV=1 54 452 2.0E-47
sp|O02350|CBPA1_ANOGA Zinc carboxypeptidase A 1 OS=Anopheles gambiae GN=AGAP009593 PE=2 SV=3 128 439 4.0E-47
sp|P09954|CBPA1_PIG Carboxypeptidase A1 OS=Sus scrofa GN=CPA1 PE=1 SV=2 125 439 4.0E-47
sp|P00732|CBPB1_BOVIN Carboxypeptidase B OS=Bos taurus GN=CPB1 PE=1 SV=2 121 450 5.0E-47
sp|Q2KIG3|CBPB2_BOVIN Carboxypeptidase B2 OS=Bos taurus GN=CPB2 PE=1 SV=1 120 438 6.0E-47
sp|B6V865|MCPA_TRITO Metallocarboxypeptidase A OS=Trichophyton tonsurans GN=MCPA PE=3 SV=1 54 452 5.0E-46
sp|B8XGR3|MCPA_TRIEQ Metallocarboxypeptidase A OS=Trichophyton equinum GN=MCPA PE=3 SV=1 54 452 7.0E-46
sp|P15085|CBPA1_HUMAN Carboxypeptidase A1 OS=Homo sapiens GN=CPA1 PE=1 SV=2 125 439 1.0E-45
sp|C5FVN6|MCPA_ARTOC Metallocarboxypeptidase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCPA PE=3 SV=1 54 452 2.0E-45
sp|Q9EQV9|CBPB2_RAT Carboxypeptidase B2 OS=Rattus norvegicus GN=Cpb2 PE=2 SV=1 120 438 4.0E-45
sp|P55261|CBPB1_CANLF Carboxypeptidase B OS=Canis lupus familiaris GN=CPB1 PE=2 SV=1 120 450 5.0E-45
sp|Q9JHH6|CBPB2_MOUSE Carboxypeptidase B2 OS=Mus musculus GN=Cpb2 PE=1 SV=1 120 438 2.0E-44
sp|Q8WXQ8|CBPA5_HUMAN Carboxypeptidase A5 OS=Homo sapiens GN=CPA5 PE=2 SV=1 115 439 6.0E-44
sp|Q96IY4|CBPB2_HUMAN Carboxypeptidase B2 OS=Homo sapiens GN=CPB2 PE=1 SV=2 120 438 8.0E-43
sp|Q4R7R2|CBPA5_MACFA Carboxypeptidase A5 OS=Macaca fascicularis GN=CPA5 PE=2 SV=1 115 439 9.0E-43
sp|P15086|CBPB1_HUMAN Carboxypeptidase B OS=Homo sapiens GN=CPB1 PE=1 SV=4 120 450 2.0E-42
sp|P09955|CBPB1_PIG Carboxypeptidase B OS=Sus scrofa GN=CPB1 PE=1 SV=5 121 454 9.0E-42
sp|Q9VL86|CBPA1_DROME Zinc carboxypeptidase A 1 OS=Drosophila melanogaster GN=CG17633 PE=2 SV=1 120 438 1.0E-41
sp|P15088|CBPA3_HUMAN Mast cell carboxypeptidase A OS=Homo sapiens GN=CPA3 PE=1 SV=2 125 450 3.0E-40
sp|P15089|CBPA3_MOUSE Mast cell carboxypeptidase A OS=Mus musculus GN=Cpa3 PE=2 SV=1 125 450 5.0E-40
sp|P21961|CBPA3_RAT Mast cell carboxypeptidase A (Fragment) OS=Rattus norvegicus GN=Cpa3 PE=1 SV=2 117 450 1.0E-39
sp|Q29NC4|CBPA1_DROPS Zinc carboxypeptidase A 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14587 PE=3 SV=1 126 438 9.0E-39
sp|P29068|CBPT_THEVU Carboxypeptidase T OS=Thermoactinomyces vulgaris GN=cpt PE=1 SV=1 124 444 5.0E-19
sp|P18143|CBPS_STRGR Zinc carboxypeptidase OS=Streptomyces griseus GN=scpD PE=1 SV=2 128 450 2.0E-17
sp|P39041|CBPS_STRMP Zinc carboxypeptidase OS=Saccharothrix mutabilis subsp. capreolus PE=3 SV=1 128 278 1.0E-13
sp|P42787|CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster GN=svr PE=1 SV=2 108 308 5.0E-08
sp|Q80V42|CBPM_MOUSE Carboxypeptidase M OS=Mus musculus GN=Cpm PE=1 SV=2 128 288 2.0E-07
sp|P14384|CBPM_HUMAN Carboxypeptidase M OS=Homo sapiens GN=CPM PE=1 SV=2 127 288 6.0E-06
sp|Q5RFD6|CBPM_PONAB Carboxypeptidase M OS=Pongo abelii GN=CPM PE=2 SV=1 127 288 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006508 proteolysis Yes
GO:0004181 metallocarboxypeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0008238 exopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0043170 macromolecule metabolic process No
GO:0008237 metallopeptidase activity No
GO:0004180 carboxypeptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0008235 metalloexopeptidase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028280
MGSGILGSFARIYTLLLISGLALAADQVVLDPPRTFTTSGILRRFSLLGDAQRKQILRSAFDNDVDIWQVTDSHI
DIYTPPHDQNTRFGFEDIPHTTSYIETKANYTYTRPDDWRLESFATSEYHATYHPLFEIEQFMDELQKLYPDTIK
LRSIGRSFEGRDLRAITLSAPSVNSTLGPISKEGKLGFVIGGAQHAREWIATAAATYIAHALVAPPSQPYSLRHL
LDTFDFHIIPVPNPDGYTYTWETDRYWYKNRQVLGSHLQCVGVDMNRNWGFKWKHTVDDVETLNTSSSLGPKRKP
PADPCSHWYPGHRPFESPEVNSVANFATTLPNLVGFLDLRSYGQMLSAPFSHSCTKMPKDAEDMLEAATGAAGAL
KSVHGVGFTIGSLCDLLYPAPGNIIDWMYKKQGIKFTFAAHLRDTGTYGFSLPEKFIRPVGEETSKLVEYLSKFI
PGRVKRKS*
Coding >AgabiH97|028280
ATGGGCTCAGGCATTCTCGGGTCCTTTGCTCGGATATACACGCTTTTGCTCATTTCAGGGCTCGCTCTCGCTGCT
GACCAGGTCGTCCTCGACCCGCCAAGAACTTTCACAACTTCGGGTATTCTGAGGCGCTTCTCTCTCCTTGGCGAC
GCTCAGAGAAAACAAATCCTACGCTCGGCCTTTGACAATGATGTTGACATCTGGCAAGTCACGGACTCCCATATC
GACATATATACCCCTCCCCACGATCAAAATACACGTTTTGGCTTTGAAGACATTCCTCACACAACCTCCTACATT
GAAACTAAAGCGAACTATACCTATACCCGCCCTGACGATTGGAGGTTGGAGTCCTTCGCTACATCCGAATACCAT
GCGACATATCACCCTTTATTCGAAATTGAACAATTCATGGATGAGCTTCAGAAACTTTATCCAGATACCATCAAG
CTTCGAAGTATAGGACGTAGCTTTGAAGGACGGGACTTGCGTGCCATTACTTTATCAGCTCCTTCCGTCAATTCC
ACCTTAGGTCCTATATCAAAAGAAGGAAAGTTAGGATTCGTCATTGGAGGAGCGCAGCATGCGCGTGAATGGATC
GCAACAGCGGCTGCAACGTACATCGCGCATGCTTTGGTTGCCCCTCCATCCCAACCTTACTCGCTCAGACATCTT
TTGGATACCTTTGACTTTCATATTATACCAGTTCCTAATCCCGATGGCTATACTTACACCTGGGAGACAGATCGG
TACTGGTACAAGAACCGCCAAGTACTCGGGTCTCACCTGCAGTGCGTCGGTGTGGATATGAACAGAAACTGGGGA
TTCAAGTGGAAACATACCGTAGACGATGTTGAAACTCTGAATACCTCTAGCAGTCTGGGTCCCAAACGTAAACCA
CCTGCTGACCCGTGCTCGCACTGGTATCCTGGTCATCGGCCTTTTGAGTCCCCCGAGGTCAATAGTGTCGCGAAC
TTTGCAACCACATTGCCTAATCTCGTCGGGTTTTTGGATTTACGCAGTTACGGACAAATGCTCTCGGCTCCCTTT
TCCCACAGCTGCACAAAGATGCCAAAGGATGCGGAGGATATGCTTGAAGCTGCTACTGGCGCAGCTGGTGCTTTG
AAATCAGTGCACGGGGTTGGGTTTACGATCGGTTCACTCTGTGATCTTCTATATCCAGCTCCCGGAAATATCATT
GACTGGATGTACAAGAAACAAGGTATAAAGTTCACCTTTGCTGCTCACCTTCGGGATACTGGGACCTATGGTTTT
TCTCTACCCGAAAAGTTTATCAGGCCAGTTGGCGAAGAGACATCCAAGCTGGTAGAGTACTTGTCAAAATTCATC
CCGGGGCGCGTCAAACGAAAATCTTGA
Transcript >AgabiH97|028280
ATGGGCTCAGGCATTCTCGGGTCCTTTGCTCGGATATACACGCTTTTGCTCATTTCAGGGCTCGCTCTCGCTGCT
GACCAGGTCGTCCTCGACCCGCCAAGAACTTTCACAACTTCGGGTATTCTGAGGCGCTTCTCTCTCCTTGGCGAC
GCTCAGAGAAAACAAATCCTACGCTCGGCCTTTGACAATGATGTTGACATCTGGCAAGTCACGGACTCCCATATC
GACATATATACCCCTCCCCACGATCAAAATACACGTTTTGGCTTTGAAGACATTCCTCACACAACCTCCTACATT
GAAACTAAAGCGAACTATACCTATACCCGCCCTGACGATTGGAGGTTGGAGTCCTTCGCTACATCCGAATACCAT
GCGACATATCACCCTTTATTCGAAATTGAACAATTCATGGATGAGCTTCAGAAACTTTATCCAGATACCATCAAG
CTTCGAAGTATAGGACGTAGCTTTGAAGGACGGGACTTGCGTGCCATTACTTTATCAGCTCCTTCCGTCAATTCC
ACCTTAGGTCCTATATCAAAAGAAGGAAAGTTAGGATTCGTCATTGGAGGAGCGCAGCATGCGCGTGAATGGATC
GCAACAGCGGCTGCAACGTACATCGCGCATGCTTTGGTTGCCCCTCCATCCCAACCTTACTCGCTCAGACATCTT
TTGGATACCTTTGACTTTCATATTATACCAGTTCCTAATCCCGATGGCTATACTTACACCTGGGAGACAGATCGG
TACTGGTACAAGAACCGCCAAGTACTCGGGTCTCACCTGCAGTGCGTCGGTGTGGATATGAACAGAAACTGGGGA
TTCAAGTGGAAACATACCGTAGACGATGTTGAAACTCTGAATACCTCTAGCAGTCTGGGTCCCAAACGTAAACCA
CCTGCTGACCCGTGCTCGCACTGGTATCCTGGTCATCGGCCTTTTGAGTCCCCCGAGGTCAATAGTGTCGCGAAC
TTTGCAACCACATTGCCTAATCTCGTCGGGTTTTTGGATTTACGCAGTTACGGACAAATGCTCTCGGCTCCCTTT
TCCCACAGCTGCACAAAGATGCCAAAGGATGCGGAGGATATGCTTGAAGCTGCTACTGGCGCAGCTGGTGCTTTG
AAATCAGTGCACGGGGTTGGGTTTACGATCGGTTCACTCTGTGATCTTCTATATCCAGCTCCCGGAAATATCATT
GACTGGATGTACAAGAAACAAGGTATAAAGTTCACCTTTGCTGCTCACCTTCGGGATACTGGGACCTATGGTTTT
TCTCTACCCGAAAAGTTTATCAGGCCAGTTGGCGAAGAGACATCCAAGCTGGTAGAGTACTTGTCAAAATTCATC
CCGGGGCGCGTCAAACGAAAATCTTGA
Gene >AgabiH97|028280
ATGGGCTCAGGCATTCTCGGGTCCTTTGCTCGGATATACACGCTTTTGCTCATTTCAGGGCTCGCTCTCGCTGCT
GACCAGGTCGTCCTCGACCCGCCAAGAACTTTCACAACTTCGGGTATTCTGAGGCGCTTCTCTCTCCTTGGCGAC
GCTCAGAGAAAACAAATCCTACGCTCGGCCTTTGTACGCATACTATAACACTATTTGCATGCTTCCTGACGTGAT
TGTATATCAGGACAATGATGTTGACATCTGGCAAGTCACGGACTCCCATATCGACATATATACCCCTCCCCACGA
TCAAAATACACGTTTTGGCTTTGAAGACATTCCTCACACAACCTCCTACATTGAAACTAAAGCGAACTATACCTA
TACCCGCCCTGACGATTGGAGGTTGGAGTCCTTCGCTACATCCGAATACCATGCGACATATCACCCTTTATTCGA
AATTGAACAATTCATGGATGAGCTTCAGAAACTTTATCCAGATACCATCAAGCTTCGAAGTATAGGACGTAGCTT
TGAAGGACGGGACTTGCGTGCCATTACTTTATCAGCTCCTTCCGTCAATTCCACCTTAGGTCCTATATCAAAAGA
AGGAAAGTTAGGATTCGTCATTGGAGGAGCGCAGCATGCGCGTGAAGTATGTATGAAGCCCCATTCGTCTTGATG
ACTTCTGAATTCAGTATGCCTAGTGGATCGCAACAGCGGCTGCAACGTACATCGCGCATGCTTTGGTTGCCCCTC
CATCCCAACCTTACTCGCTCAGACATCTTTTGGATACCTTTGTGCGCCTCCGACATGATCACGCTAACAAGTCCC
CTAATCCCGACATAGGACTTTCATATTATACCAGTTCCTAATCCCGATGGCTATACTTACACCTGGGAGACAGAT
CGGTACTGGTATGTGCTACTCCATCTCTTCGTCTCCTGGGGATCTCATAGGGCATAGGTACAAGAACCGCCAAGT
ACTCGGGTCTCACCTGCAGTGCGTCGGTGTGGATATGAACAGGTTCGCTGAATGCCGCTTAAATCTTGTTCGTTT
TCTGATCGCTTGGCCTGGCTAATAAGAAACTGGGTGAGCGTTTTTGCTGGCCTAATCGCCGTCTAGAAACTGATA
TCTGTTGCCTTTGTAGGGATTCAAGTGGAAACATACCGTAGACGATGTTGAAACTCTGAATACCTCTAGCAGTCT
GGGTCCCAAACGTAAACCACCTGCTGACCCGTGCTCGCACTGGTATCCTGGTCATCGGCCTTTTGAGTCCCCCGA
GGTCAATAGTGTCGCGAACTTTGCAACCACATTGCCTAATCTCGTCGGGTTTTTGGATTTACGCAGTTACGGACA
AATGCGTACGTACAGACTATCCTCGGCCATTCATTCTGAACTTAGAAGCCCTAGTCTCGGCTCCCTTTTCCCACA
GCTGCACAAAGATGCCAAAGGATGCGGAGGATATGCTTGAAGCTGCTACTGGCGCAGCTGGTGCTTTGAAATCAG
TGCACGGGGTTGGGTTTACGGTGACCAAGTCATGATCCGTCCTTTCCTAGCTTCTGCTGATGCACACTATCTTCC
ACAGATCGGTTCACTCTGTGATCTTCTATATCCAGCTCCCGGAAATATCATTGACTGGATGTACAAGAAACAAGG
TATAAAGTTCACCTTTGCTGCTCACCTTCGGGATACTGGGACCGTGAGTTCCGTCATCTTCAATTCCAAAGCTTG
TTAAGACTCATACCATTCAATGTTGAAGTATGGTTTTTCTCTACCCGAAAAGTTTATCAGGCCAGTTGGCGAAGA
GACATCCAAGCTGGTAGAGTACTTGTCAAAATTCATCCCGGGGCGCGTCAAACGTGAGGTGTACTTCTCCTTTCG
ACGCATTCTATATGCTTATGTAAAGACCCCAGGAAAATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail