Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028070
Gene name
Locationscaffold_11:1694037..1698153
Strand+
Gene length (bp)4116
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 6.5E-50 463 662
PF00679 EFG_C Elongation factor G C-terminus 3.4E-16 880 961

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 464 1077 7.0E-167
sp|P44910|TYPA_HAEIN GTP-binding protein TypA/BipA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=typA PE=1 SV=1 462 1086 2.0E-162
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 464 1084 3.0E-160
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 462 1086 3.0E-160
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 462 1086 3.0E-160
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 464 1077 7.0E-167
sp|P44910|TYPA_HAEIN GTP-binding protein TypA/BipA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=typA PE=1 SV=1 462 1086 2.0E-162
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 464 1084 3.0E-160
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 462 1086 3.0E-160
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 462 1086 3.0E-160
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 462 1086 3.0E-160
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 462 1086 3.0E-160
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 462 1086 3.0E-160
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 462 1087 1.0E-157
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 462 1087 7.0E-157
sp|P57508|TYPA_BUCAI GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=typA PE=3 SV=1 464 1087 2.0E-154
sp|Q8K9C8|TYPA_BUCAP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=typA PE=3 SV=1 462 1087 4.0E-150
sp|Q89AC9|TYPA_BUCBP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=typA PE=3 SV=2 462 1085 1.0E-147
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 459 872 8.0E-40
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 463 976 2.0E-39
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 462 979 6.0E-39
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 462 979 6.0E-39
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 463 976 7.0E-39
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 463 976 1.0E-38
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 463 976 1.0E-38
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 463 1007 1.0E-38
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 460 869 1.0E-38
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 463 976 1.0E-38
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 463 976 1.0E-38
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 463 976 2.0E-38
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 463 976 2.0E-38
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 463 976 2.0E-38
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 463 976 2.0E-38
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 463 1007 2.0E-38
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 463 1007 2.0E-38
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 463 1007 2.0E-38
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 463 976 2.0E-38
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 462 1007 3.0E-38
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 463 976 3.0E-38
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 463 976 3.0E-38
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 463 976 3.0E-38
sp|B9DNK4|LEPA_STACT Elongation factor 4 OS=Staphylococcus carnosus (strain TM300) GN=lepA PE=3 SV=1 462 979 4.0E-38
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 462 1007 4.0E-38
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 463 1007 5.0E-38
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 462 1007 7.0E-38
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 462 979 8.0E-38
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 460 869 1.0E-37
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 462 1007 1.0E-37
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 462 976 2.0E-37
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 462 1007 2.0E-37
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 460 904 2.0E-37
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 460 904 2.0E-37
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 457 957 2.0E-37
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 462 976 3.0E-37
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 463 1007 3.0E-37
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 462 976 3.0E-37
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 462 976 3.0E-37
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 462 1007 4.0E-37
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 462 1007 4.0E-37
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 464 958 4.0E-37
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 463 976 4.0E-37
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 461 869 5.0E-37
sp|Q8CP13|LEPA_STAES Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lepA PE=3 SV=1 462 979 5.0E-37
sp|Q5HNW2|LEPA_STAEQ Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lepA PE=3 SV=1 462 979 5.0E-37
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 457 989 5.0E-37
sp|B1YKS5|LEPA_EXIS2 Elongation factor 4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=lepA PE=3 SV=1 464 976 6.0E-37
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 462 1007 7.0E-37
sp|C4K3Z1|LEPA_HAMD5 Elongation factor 4 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=lepA PE=3 SV=1 465 984 7.0E-37
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 444 869 7.0E-37
sp|Q7N1X3|LEPA_PHOLL Elongation factor 4 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lepA PE=3 SV=1 462 977 1.0E-36
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 462 1007 1.0E-36
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 462 1007 1.0E-36
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 463 1007 1.0E-36
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 463 1007 1.0E-36
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 463 1007 1.0E-36
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 463 1007 1.0E-36
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 455 869 1.0E-36
sp|Q8NWA7|LEPA_STAAW Elongation factor 4 OS=Staphylococcus aureus (strain MW2) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 462 1007 2.0E-36
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 462 1007 2.0E-36
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 462 1007 2.0E-36
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 458 957 2.0E-36
sp|Q6G8Y3|LEPA_STAAS Elongation factor 4 OS=Staphylococcus aureus (strain MSSA476) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|Q6GGB6|LEPA_STAAR Elongation factor 4 OS=Staphylococcus aureus (strain MRSA252) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|P65272|LEPA_STAAN Elongation factor 4 OS=Staphylococcus aureus (strain N315) GN=lepA PE=1 SV=1 462 979 2.0E-36
sp|P65271|LEPA_STAAM Elongation factor 4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|Q2YT42|LEPA_STAAB Elongation factor 4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|A5ITB2|LEPA_STAA9 Elongation factor 4 OS=Staphylococcus aureus (strain JH9) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|A6U257|LEPA_STAA2 Elongation factor 4 OS=Staphylococcus aureus (strain JH1) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|A7X2Y7|LEPA_STAA1 Elongation factor 4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|A8Z4C4|LEPA_STAAT Elongation factor 4 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|A6QHC7|LEPA_STAAE Elongation factor 4 OS=Staphylococcus aureus (strain Newman) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|Q5HFH6|LEPA_STAAC Elongation factor 4 OS=Staphylococcus aureus (strain COL) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|Q2FXY7|LEPA_STAA8 Elongation factor 4 OS=Staphylococcus aureus (strain NCTC 8325) GN=lepA PE=1 SV=1 462 979 2.0E-36
sp|Q2FGD9|LEPA_STAA3 Elongation factor 4 OS=Staphylococcus aureus (strain USA300) GN=lepA PE=3 SV=1 462 979 2.0E-36
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 463 1007 2.0E-36
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 462 1007 2.0E-36
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 462 1007 2.0E-36
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 462 869 3.0E-36
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 463 971 4.0E-36
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 462 956 4.0E-36
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 459 869 4.0E-36
sp|A4SRD4|LEPA_AERS4 Elongation factor 4 OS=Aeromonas salmonicida (strain A449) GN=lepA PE=3 SV=1 462 977 4.0E-36
sp|A9M3J8|LEPA_NEIM0 Elongation factor 4 OS=Neisseria meningitidis serogroup C (strain 053442) GN=lepA PE=3 SV=1 462 976 4.0E-36
sp|A1KT27|LEPA_NEIMF Elongation factor 4 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lepA PE=3 SV=1 462 976 5.0E-36
sp|B4RK41|LEPA_NEIG2 Elongation factor 4 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lepA PE=3 SV=1 462 976 5.0E-36
sp|Q5F9P9|LEPA_NEIG1 Elongation factor 4 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lepA PE=3 SV=1 462 976 5.0E-36
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 459 869 6.0E-36
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 459 869 6.0E-36
sp|B1XTL2|LEPA_POLNS Elongation factor 4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lepA PE=3 SV=1 464 976 6.0E-36
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 462 1007 6.0E-36
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 462 961 6.0E-36
sp|Q9K055|LEPA_NEIMB Elongation factor 4 OS=Neisseria meningitidis serogroup B (strain MC58) GN=lepA PE=3 SV=1 462 976 6.0E-36
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 462 1007 7.0E-36
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 463 1007 7.0E-36
sp|Q3J8D2|LEPA_NITOC Elongation factor 4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lepA PE=3 SV=1 456 980 8.0E-36
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 462 986 9.0E-36
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 459 956 1.0E-35
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 460 869 1.0E-35
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 463 980 1.0E-35
sp|Q87LN7|LEPA_VIBPA Elongation factor 4 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 463 976 1.0E-35
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 455 869 1.0E-35
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 462 957 1.0E-35
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 462 1007 1.0E-35
sp|Q9JV65|LEPA_NEIMA Elongation factor 4 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lepA PE=3 SV=1 462 976 1.0E-35
sp|A5IYS0|LEPA_MYCAP Elongation factor 4 OS=Mycoplasma agalactiae (strain PG2) GN=lepA PE=3 SV=1 463 986 1.0E-35
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 462 957 1.0E-35
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 463 971 2.0E-35
sp|A7I1F0|LEPA_CAMHC Elongation factor 4 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lepA PE=3 SV=1 462 962 2.0E-35
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 462 1007 2.0E-35
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 462 976 2.0E-35
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 462 1007 2.0E-35
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 463 956 3.0E-35
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 462 1007 3.0E-35
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 462 1007 3.0E-35
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 457 967 3.0E-35
sp|Q1LTI1|LEPA_BAUCH Elongation factor 4 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lepA PE=3 SV=1 462 985 3.0E-35
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 463 971 3.0E-35
sp|A3PBD8|LEPA_PROM0 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9301) GN=lepA PE=3 SV=1 457 971 3.0E-35
sp|Q6KHP1|LEPA_MYCMO Elongation factor 4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lepA PE=3 SV=1 463 956 3.0E-35
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 462 986 3.0E-35
sp|Q5E312|LEPA_VIBF1 Elongation factor 4 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lepA PE=3 SV=1 462 1007 3.0E-35
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 457 971 3.0E-35
sp|Q31CB8|LEPA_PROM9 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=lepA PE=3 SV=1 463 971 3.0E-35
sp|A2BPP8|LEPA_PROMS Elongation factor 4 OS=Prochlorococcus marinus (strain AS9601) GN=lepA PE=3 SV=1 457 971 3.0E-35
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 464 977 4.0E-35
sp|C3LR06|LEPA_VIBCM Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|Q9KPB0|LEPA_VIBCH Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|A5F5G3|LEPA_VIBC3 Elongation factor 4 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|A9L5N4|LEPA_SHEB9 Elongation factor 4 OS=Shewanella baltica (strain OS195) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|B8EBQ4|LEPA_SHEB2 Elongation factor 4 OS=Shewanella baltica (strain OS223) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|A7MZB0|LEPA_VIBCB Elongation factor 4 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|A6WKQ5|LEPA_SHEB8 Elongation factor 4 OS=Shewanella baltica (strain OS185) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|A3D1V4|LEPA_SHEB5 Elongation factor 4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lepA PE=3 SV=1 462 1007 5.0E-35
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 459 869 5.0E-35
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 462 976 6.0E-35
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 462 977 6.0E-35
sp|P47384|LEPA_MYCGE Elongation factor 4 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lepA PE=3 SV=1 462 977 6.0E-35
sp|Q6D217|LEPA_PECAS Elongation factor 4 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lepA PE=3 SV=1 462 1007 7.0E-35
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 463 971 7.0E-35
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 462 982 7.0E-35
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 462 1007 7.0E-35
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 462 961 7.0E-35
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 462 961 7.0E-35
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 459 869 8.0E-35
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 462 979 8.0E-35
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 460 957 8.0E-35
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 461 966 8.0E-35
sp|Q5N390|LEPA_SYNP6 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lepA PE=3 SV=2 457 967 9.0E-35
sp|A0KGF0|LEPA_AERHH Elongation factor 4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lepA PE=3 SV=1 462 977 1.0E-34
sp|A1S3X9|LEPA_SHEAM Elongation factor 4 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lepA PE=3 SV=1 462 1007 1.0E-34
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 462 958 1.0E-34
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 462 977 2.0E-34
sp|Q5SKA7|LEPA_THET8 Elongation factor 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lepA PE=1 SV=1 463 958 2.0E-34
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 462 873 2.0E-34
sp|B5FAH2|LEPA_VIBFM Elongation factor 4 OS=Vibrio fischeri (strain MJ11) GN=lepA PE=3 SV=1 462 1007 2.0E-34
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 462 962 2.0E-34
sp|Q5HU70|LEPA_CAMJR Elongation factor 4 OS=Campylobacter jejuni (strain RM1221) GN=lepA PE=3 SV=1 459 960 2.0E-34
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 464 958 2.0E-34
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 462 881 2.0E-34
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 462 977 2.0E-34
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 462 977 2.0E-34
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 462 976 3.0E-34
sp|A1W018|LEPA_CAMJJ Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lepA PE=3 SV=1 459 960 3.0E-34
sp|Q9PNR1|LEPA_CAMJE Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lepA PE=3 SV=1 459 960 3.0E-34
sp|A8FM79|LEPA_CAMJ8 Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lepA PE=3 SV=1 459 960 3.0E-34
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 463 956 3.0E-34
sp|Q8EH83|LEPA_SHEON Elongation factor 4 OS=Shewanella oneidensis (strain MR-1) GN=lepA PE=3 SV=1 462 1007 3.0E-34
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 463 869 3.0E-34
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 462 976 3.0E-34
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 462 961 3.0E-34
sp|Q72KV2|LEPA_THET2 Elongation factor 4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lepA PE=3 SV=1 463 958 4.0E-34
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 462 960 4.0E-34
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 464 981 4.0E-34
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 462 976 4.0E-34
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 462 976 4.0E-34
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 462 976 4.0E-34
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 462 976 4.0E-34
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 462 961 4.0E-34
sp|Q492C9|LEPA_BLOPB Elongation factor 4 OS=Blochmannia pennsylvanicus (strain BPEN) GN=lepA PE=3 SV=1 464 957 4.0E-34
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 464 957 4.0E-34
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 462 976 4.0E-34
sp|B6EKN1|LEPA_ALISL Elongation factor 4 OS=Aliivibrio salmonicida (strain LFI1238) GN=lepA PE=3 SV=1 462 1007 4.0E-34
sp|P75498|LEPA_MYCPN Elongation factor 4 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lepA PE=3 SV=2 462 957 5.0E-34
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 464 986 5.0E-34
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 462 877 5.0E-34
sp|Q7UX15|LEPA1_RHOBA Elongation factor 4 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA1 PE=3 SV=1 453 977 5.0E-34
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 462 1007 5.0E-34
sp|B9KD01|LEPA_CAMLR Elongation factor 4 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=lepA PE=3 SV=1 462 960 6.0E-34
sp|D0NKK0|GUF1_PHYIT Translation factor GUF1 homolog, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_12454 PE=3 SV=1 459 964 6.0E-34
sp|A8G3D2|LEPA_PROM2 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9215) GN=lepA PE=3 SV=1 457 971 6.0E-34
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 461 869 7.0E-34
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 457 971 8.0E-34
sp|C6DC02|LEPA_PECCP Elongation factor 4 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lepA PE=3 SV=1 462 977 9.0E-34
sp|Q050R3|LEPA_LEPBL Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lepA PE=3 SV=1 464 976 9.0E-34
sp|Q04SN9|LEPA_LEPBJ Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lepA PE=3 SV=1 464 976 9.0E-34
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 462 1007 1.0E-33
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 460 749 1.0E-33
sp|A4RZA6|GUFP_OSTLU Translation factor GUF1 homolog, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_15891 PE=3 SV=1 458 956 1.0E-33
sp|A0KZN4|LEPA_SHESA Elongation factor 4 OS=Shewanella sp. (strain ANA-3) GN=lepA PE=3 SV=1 462 1007 1.0E-33
sp|Q0HSI9|LEPA_SHESR Elongation factor 4 OS=Shewanella sp. (strain MR-7) GN=lepA PE=3 SV=1 462 1007 1.0E-33
sp|Q0HG96|LEPA_SHESM Elongation factor 4 OS=Shewanella sp. (strain MR-4) GN=lepA PE=3 SV=1 462 1007 1.0E-33
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 462 977 1.0E-33
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 462 977 1.0E-33
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 463 956 1.0E-33
sp|Q4UKS2|LEPA_RICFE Elongation factor 4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lepA PE=3 SV=1 464 966 1.0E-33
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 462 856 1.0E-33
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 464 957 1.0E-33
sp|Q49Y26|LEPA_STAS1 Elongation factor 4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lepA PE=3 SV=1 464 976 1.0E-33
sp|C5BRN3|LEPA_TERTT Elongation factor 4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lepA PE=3 SV=1 464 960 1.0E-33
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 461 987 1.0E-33
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 463 956 1.0E-33
sp|A1AWP9|LEPA_RUTMC Elongation factor 4 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lepA PE=3 SV=1 462 908 1.0E-33
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 460 883 1.0E-33
sp|Q3AWX3|LEPA_SYNS9 Elongation factor 4 OS=Synechococcus sp. (strain CC9902) GN=lepA PE=3 SV=1 463 971 1.0E-33
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 464 979 2.0E-33
sp|Q9PQG7|LEPA_UREPA Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=lepA PE=3 SV=1 464 977 2.0E-33
sp|B1AIW2|LEPA_UREP2 Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lepA PE=3 SV=1 464 977 2.0E-33
sp|B3R202|LEPA_CUPTR Elongation factor 4 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lepA PE=3 SV=1 462 976 2.0E-33
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 463 956 2.0E-33
sp|A9KF98|LEPA_COXBN Elongation factor 4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lepA PE=3 SV=1 457 957 2.0E-33
sp|P56865|LEPA_BORPE Elongation factor 4 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lepA PE=3 SV=2 462 980 2.0E-33
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 462 956 2.0E-33
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 464 979 2.0E-33
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 464 979 2.0E-33
sp|B5ZBD4|LEPA_UREU1 Elongation factor 4 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=lepA PE=3 SV=1 464 977 2.0E-33
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 459 956 2.0E-33
sp|B1JRC5|LEPA_YERPY Elongation factor 4 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|Q667U9|LEPA_YERPS Elongation factor 4 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|Q1CKE6|LEPA_YERPN Elongation factor 4 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|A9R400|LEPA_YERPG Elongation factor 4 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|Q8ZD74|LEPA_YERPE Elongation factor 4 OS=Yersinia pestis GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|B2KA49|LEPA_YERPB Elongation factor 4 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|Q1C557|LEPA_YERPA Elongation factor 4 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|A7FFT7|LEPA_YERP3 Elongation factor 4 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lepA PE=3 SV=1 462 977 2.0E-33
sp|A8GRF6|LEPA_RICRS Elongation factor 4 OS=Rickettsia rickettsii (strain Sheila Smith) GN=lepA PE=3 SV=1 464 967 2.0E-33
sp|B0BWV5|LEPA_RICRO Elongation factor 4 OS=Rickettsia rickettsii (strain Iowa) GN=lepA PE=3 SV=1 464 967 2.0E-33
sp|Q8GCP5|LEPA_MYCFP Elongation factor 4 OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lepA PE=3 SV=1 463 989 3.0E-33
sp|A4TKY0|LEPA_YERPP Elongation factor 4 OS=Yersinia pestis (strain Pestoides F) GN=lepA PE=3 SV=1 464 977 3.0E-33
sp|B2SZV7|LEPA_BURPP Elongation factor 4 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lepA PE=3 SV=1 462 979 3.0E-33
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 457 971 3.0E-33
sp|Q59P53|GUF1_CANAL Translation factor GUF1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUF1 PE=3 SV=1 462 966 3.0E-33
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 458 977 3.0E-33
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 462 958 3.0E-33
sp|Q7MHN6|LEPA_VIBVY Elongation factor 4 OS=Vibrio vulnificus (strain YJ016) GN=lepA PE=3 SV=1 462 1007 3.0E-33
sp|Q8DC78|LEPA_VIBVU Elongation factor 4 OS=Vibrio vulnificus (strain CMCP6) GN=lepA PE=3 SV=1 462 1007 3.0E-33
sp|C4YIT6|GUF1_CANAW Translation factor GUF1, mitochondrial OS=Candida albicans (strain WO-1) GN=GUF1 PE=3 SV=1 462 966 3.0E-33
sp|Q1AVV0|LEPA_RUBXD Elongation factor 4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lepA PE=3 SV=1 457 958 3.0E-33
sp|Q13VM6|LEPA_BURXL Elongation factor 4 OS=Burkholderia xenovorans (strain LB400) GN=lepA PE=3 SV=1 462 979 3.0E-33
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 464 976 3.0E-33
sp|Q7W5J4|LEPA_BORPA Elongation factor 4 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lepA PE=3 SV=1 462 980 3.0E-33
sp|Q7WD30|LEPA_BORBR Elongation factor 4 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lepA PE=3 SV=1 462 980 3.0E-33
sp|A8GMT1|LEPA_RICAH Elongation factor 4 OS=Rickettsia akari (strain Hartford) GN=lepA PE=3 SV=1 464 966 4.0E-33
sp|Q83BK3|LEPA_COXBU Elongation factor 4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lepA PE=3 SV=2 457 957 4.0E-33
sp|A9N944|LEPA_COXBR Elongation factor 4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lepA PE=3 SV=1 457 957 4.0E-33
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 462 958 4.0E-33
sp|A3QBS5|LEPA_SHELP Elongation factor 4 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lepA PE=3 SV=1 462 979 4.0E-33
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 461 958 4.0E-33
sp|Q9ZHZ8|LEPA_MYCH2 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 232) GN=lepA PE=3 SV=3 462 919 4.0E-33
sp|Q4AAQ8|LEPA_MYCHJ Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lepA PE=3 SV=1 462 919 4.0E-33
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 457 971 5.0E-33
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 462 966 5.0E-33
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 464 967 5.0E-33
sp|C5BAI0|LEPA_EDWI9 Elongation factor 4 OS=Edwardsiella ictaluri (strain 93-146) GN=lepA PE=3 SV=1 462 977 5.0E-33
sp|A7H311|LEPA_CAMJD Elongation factor 4 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lepA PE=3 SV=1 462 960 5.0E-33
sp|Q4A8T9|LEPA_MYCH7 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 7448) GN=lepA PE=3 SV=1 462 869 5.0E-33
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 462 960 6.0E-33
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 449 869 6.0E-33
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 460 869 6.0E-33
sp|Q4A5S3|LEPA_MYCS5 Elongation factor 4 OS=Mycoplasma synoviae (strain 53) GN=lepA PE=3 SV=1 463 977 6.0E-33
sp|A1K601|LEPA_AZOSB Elongation factor 4 OS=Azoarcus sp. (strain BH72) GN=lepA PE=3 SV=1 462 994 7.0E-33
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 463 1007 7.0E-33
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 462 869 7.0E-33
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 461 958 7.0E-33
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 449 869 7.0E-33
sp|A8GI27|LEPA_SERP5 Elongation factor 4 OS=Serratia proteamaculans (strain 568) GN=lepA PE=3 SV=1 462 977 8.0E-33
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 462 979 8.0E-33
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 462 960 8.0E-33
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 462 961 8.0E-33
sp|Q8K9Q9|LEPA_BUCAP Elongation factor 4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lepA PE=3 SV=1 462 977 9.0E-33
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 464 957 9.0E-33
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 464 957 9.0E-33
sp|Q7UE01|LEPA2_RHOBA Elongation factor 4 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA2 PE=3 SV=1 462 966 9.0E-33
sp|A8GW16|LEPA_RICB8 Elongation factor 4 OS=Rickettsia bellii (strain OSU 85-389) GN=lepA PE=3 SV=1 464 967 9.0E-33
sp|B8CQJ7|LEPA_SHEPW Elongation factor 4 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lepA PE=3 SV=1 462 976 1.0E-32
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 462 961 1.0E-32
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 464 957 1.0E-32
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 463 986 1.0E-32
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 462 956 1.0E-32
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 440 908 1.0E-32
sp|A5GMR2|LEPA_SYNPW Elongation factor 4 OS=Synechococcus sp. (strain WH7803) GN=lepA PE=3 SV=1 463 971 1.0E-32
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 465 979 1.0E-32
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 463 958 1.0E-32
sp|B9GHA6|GUFP_POPTR Translation factor GUF1 homolog, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_815670 PE=3 SV=2 464 957 2.0E-32
sp|Q8F500|LEPA_LEPIN Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lepA PE=3 SV=1 464 976 2.0E-32
sp|Q72QU8|LEPA_LEPIC Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lepA PE=3 SV=1 464 976 2.0E-32
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 464 981 2.0E-32
sp|B7KJX0|LEPA_CYAP7 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7424) GN=lepA PE=3 SV=1 463 986 2.0E-32
sp|Q2KWY3|LEPA_BORA1 Elongation factor 4 OS=Bordetella avium (strain 197N) GN=lepA PE=3 SV=1 462 976 2.0E-32
sp|Q12KH9|LEPA_SHEDO Elongation factor 4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lepA PE=3 SV=1 462 1007 2.0E-32
sp|Q9ZDQ1|LEPA_RICPR Elongation factor 4 OS=Rickettsia prowazekii (strain Madrid E) GN=lepA PE=3 SV=1 464 957 2.0E-32
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 449 869 2.0E-32
sp|A7Z6W5|LEPA_BACMF Elongation factor 4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lepA PE=3 SV=1 463 1007 2.0E-32
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 464 957 2.0E-32
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 464 957 2.0E-32
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 462 976 3.0E-32
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 457 971 3.0E-32
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 462 956 3.0E-32
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 462 956 3.0E-32
sp|Q2NS11|LEPA_SODGM Elongation factor 4 OS=Sodalis glossinidius (strain morsitans) GN=lepA PE=3 SV=1 462 977 3.0E-32
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 462 960 3.0E-32
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 464 956 3.0E-32
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 462 985 3.0E-32
sp|B3PLG4|LEPA_CELJU Elongation factor 4 OS=Cellvibrio japonicus (strain Ueda107) GN=lepA PE=3 SV=1 464 979 3.0E-32
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 464 976 3.0E-32
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 462 976 3.0E-32
sp|B1XK44|LEPA_SYNP2 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=lepA PE=3 SV=1 463 989 3.0E-32
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 462 907 3.0E-32
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 464 967 4.0E-32
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 462 966 4.0E-32
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 462 966 4.0E-32
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 449 869 4.0E-32
sp|B8D7F7|LEPA_BUCAT Elongation factor 4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=lepA PE=3 SV=1 462 977 4.0E-32
sp|B8D953|LEPA_BUCA5 Elongation factor 4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=lepA PE=3 SV=1 462 977 4.0E-32
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 462 966 4.0E-32
sp|P57348|LEPA_BUCAI Elongation factor 4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lepA PE=3 SV=1 464 977 4.0E-32
sp|Q8YU48|LEPA_NOSS1 Elongation factor 4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lepA PE=3 SV=1 463 1004 4.0E-32
sp|A5WCD6|LEPA_PSYWF Elongation factor 4 OS=Psychrobacter sp. (strain PRwf-1) GN=lepA PE=3 SV=1 464 979 4.0E-32
sp|Q98QW3|LEPA_MYCPU Elongation factor 4 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lepA PE=3 SV=2 463 977 4.0E-32
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 462 984 5.0E-32
sp|A8QCE7|GUF1_BRUMA Translation factor GUF1 homolog, mitochondrial OS=Brugia malayi GN=Bm1_49530 PE=3 SV=1 458 795 5.0E-32
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 462 976 6.0E-32
sp|B9WBR8|GUF1_CANDC Translation factor GUF1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GUF1 PE=3 SV=1 462 966 6.0E-32
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 462 970 6.0E-32
sp|Q3IDL4|LEPA_PSEHT Elongation factor 4 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lepA PE=3 SV=1 462 984 7.0E-32
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 462 869 7.0E-32
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 462 872 8.0E-32
sp|A8XT37|GUF1_CAEBR Translation factor GUF1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG18137 PE=3 SV=1 457 705 8.0E-32
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 463 976 8.0E-32
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 462 976 1.0E-31
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 462 971 1.0E-31
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 462 960 1.0E-31
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 461 956 1.0E-31
sp|B3EPG7|LEPA_CHLPB Elongation factor 4 OS=Chlorobium phaeobacteroides (strain BS1) GN=lepA PE=3 SV=1 464 956 1.0E-31
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 463 971 1.0E-31
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 462 869 1.0E-31
sp|Q0V3J4|GUF1_PHANO Translation factor GUF1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUF1 PE=3 SV=2 443 986 1.0E-31
sp|Q6A9B2|LEPA_PROAC Elongation factor 4 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=lepA PE=3 SV=1 458 989 1.0E-31
sp|B2U978|LEPA_RALPJ Elongation factor 4 OS=Ralstonia pickettii (strain 12J) GN=lepA PE=3 SV=1 462 979 1.0E-31
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 462 989 1.0E-31
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 461 869 1.0E-31
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 460 956 1.0E-31
sp|Q31HP5|LEPA_THICR Elongation factor 4 OS=Thiomicrospira crunogena (strain XCL-2) GN=lepA PE=3 SV=1 462 957 1.0E-31
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 462 869 1.0E-31
sp|Q8Y0I4|LEPA_RALSO Elongation factor 4 OS=Ralstonia solanacearum (strain GMI1000) GN=lepA PE=3 SV=1 462 979 1.0E-31
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 462 869 2.0E-31
sp|B1V9C5|LEPA_PHYAS Elongation factor 4 OS=Phytoplasma australiense GN=lepA PE=3 SV=1 462 956 2.0E-31
sp|Q1QX26|LEPA_CHRSD Elongation factor 4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lepA PE=3 SV=1 464 960 2.0E-31
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 464 957 2.0E-31
sp|A1SSM6|LEPA_PSYIN Elongation factor 4 OS=Psychromonas ingrahamii (strain 37) GN=lepA PE=3 SV=1 462 977 2.0E-31
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 464 955 2.0E-31
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 462 979 2.0E-31
sp|B4S9B7|LEPA_PROA2 Elongation factor 4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=lepA PE=3 SV=1 456 956 2.0E-31
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 462 976 2.0E-31
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 462 976 2.0E-31
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 462 976 2.0E-31
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 462 976 2.0E-31
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 462 869 2.0E-31
sp|B4F049|LEPA_PROMH Elongation factor 4 OS=Proteus mirabilis (strain HI4320) GN=lepA PE=3 SV=1 462 977 2.0E-31
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 464 976 2.0E-31
sp|Q89AM5|LEPA_BUCBP Elongation factor 4 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lepA PE=3 SV=1 462 957 2.0E-31
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 462 956 2.0E-31
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 462 976 2.0E-31
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 463 976 3.0E-31
sp|B8BYH3|GUF1_THAPS Translation factor GUF1 homolog, mitochondrial OS=Thalassiosira pseudonana GN=THAPSDRAFT_40001 PE=3 SV=1 457 956 3.0E-31
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 463 1004 3.0E-31
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 463 976 3.0E-31
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 462 869 3.0E-31
sp|A4JCQ9|LEPA_BURVG Elongation factor 4 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lepA PE=3 SV=1 462 979 3.0E-31
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 462 976 3.0E-31
sp|Q1IV51|LEPA_KORVE Elongation factor 4 OS=Koribacter versatilis (strain Ellin345) GN=lepA PE=3 SV=1 464 955 3.0E-31
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 461 750 3.0E-31
sp|B3QZT9|LEPA_PHYMT Elongation factor 4 OS=Phytoplasma mali (strain AT) GN=lepA PE=3 SV=1 462 956 3.0E-31
sp|P37949|LEPA_BACSU Elongation factor 4 OS=Bacillus subtilis (strain 168) GN=lepA PE=3 SV=2 463 1007 4.0E-31
sp|A0LI00|LEPA_SYNFM Elongation factor 4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lepA PE=3 SV=1 463 976 4.0E-31
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 464 967 4.0E-31
sp|A7MH13|LEPA_CROS8 Elongation factor 4 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lepA PE=3 SV=1 462 977 4.0E-31
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 459 749 4.0E-31
sp|B6IUG3|LEPA_RHOCS Elongation factor 4 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lepA PE=3 SV=1 463 967 4.0E-31
sp|B1KI55|LEPA_SHEWM Elongation factor 4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lepA PE=3 SV=1 462 976 4.0E-31
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 462 989 4.0E-31
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 463 971 4.0E-31
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 463 986 4.0E-31
sp|Q47EG0|LEPA_DECAR Elongation factor 4 OS=Dechloromonas aromatica (strain RCB) GN=lepA PE=3 SV=1 462 976 4.0E-31
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 462 971 5.0E-31
sp|Q63S94|LEPA_BURPS Elongation factor 4 OS=Burkholderia pseudomallei (strain K96243) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|A3NBT1|LEPA_BURP6 Elongation factor 4 OS=Burkholderia pseudomallei (strain 668) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|Q3JQ75|LEPA_BURP1 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1710b) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|A3NXL8|LEPA_BURP0 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1106a) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|A1V6B9|LEPA_BURMS Elongation factor 4 OS=Burkholderia mallei (strain SAVP1) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|Q62LT1|LEPA_BURMA Elongation factor 4 OS=Burkholderia mallei (strain ATCC 23344) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|A2S9Z3|LEPA_BURM9 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10229) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|A3MM44|LEPA_BURM7 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10247) GN=lepA PE=3 SV=1 462 979 5.0E-31
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 462 976 6.0E-31
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 462 976 6.0E-31
sp|Q2SXT6|LEPA_BURTA Elongation factor 4 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lepA PE=3 SV=1 462 979 6.0E-31
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 463 971 6.0E-31
sp|P60792|LEPA_ONYPE Elongation factor 4 OS=Onion yellows phytoplasma (strain OY-M) GN=lepA PE=3 SV=1 462 956 7.0E-31
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 452 951 7.0E-31
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 462 989 7.0E-31
sp|A1CLD7|GUF1_ASPCL Translation factor guf1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=guf1 PE=3 SV=1 462 966 8.0E-31
sp|B7VK81|LEPA_VIBTL Elongation factor 4 OS=Vibrio tasmaniensis (strain LGP32) GN=lepA PE=3 SV=1 462 957 8.0E-31
sp|Q0VP16|LEPA_ALCBS Elongation factor 4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lepA PE=3 SV=1 462 979 8.0E-31
sp|A8EY28|LEPA_RICCK Elongation factor 4 OS=Rickettsia canadensis (strain McKiel) GN=lepA PE=3 SV=1 464 966 8.0E-31
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 462 976 8.0E-31
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 462 976 8.0E-31
sp|B7K3Z7|LEPA_CYAP8 Elongation factor 4 OS=Cyanothece sp. (strain PCC 8801) GN=lepA PE=3 SV=1 463 986 8.0E-31
sp|B1VY28|LEPA_STRGG Elongation factor 4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lepA PE=3 SV=1 461 987 9.0E-31
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 457 956 9.0E-31
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 462 976 9.0E-31
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 462 976 9.0E-31
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 461 987 1.0E-30
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 461 884 1.0E-30
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 461 869 1.0E-30
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 464 958 1.0E-30
sp|C1D7L2|LEPA_LARHH Elongation factor 4 OS=Laribacter hongkongensis (strain HLHK9) GN=lepA PE=3 SV=1 462 976 1.0E-30
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 463 971 1.0E-30
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 462 976 1.0E-30
sp|B2JFK0|LEPA_BURP8 Elongation factor 4 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lepA PE=3 SV=1 462 979 1.0E-30
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 462 976 1.0E-30
sp|Q0BP65|LEPA_FRATO Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lepA PE=3 SV=1 462 986 1.0E-30
sp|Q2A5X6|LEPA_FRATH Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lepA PE=3 SV=1 462 986 1.0E-30
sp|A7N9A4|LEPA_FRATF Elongation factor 4 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lepA PE=3 SV=1 462 986 1.0E-30
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 462 976 1.0E-30
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 464 976 1.0E-30
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 464 976 1.0E-30
sp|Q2GGA6|LEPA_EHRCR Elongation factor 4 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lepA PE=3 SV=1 464 907 1.0E-30
sp|Q5NEF8|LEPA_FRATT Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lepA PE=3 SV=1 462 986 2.0E-30
sp|Q14FW1|LEPA_FRAT1 Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lepA PE=3 SV=1 462 986 2.0E-30
sp|A0Q453|LEPA_FRATN Elongation factor 4 OS=Francisella tularensis subsp. novicida (strain U112) GN=lepA PE=3 SV=1 462 986 2.0E-30
sp|Q3Z864|LEPA_DEHM1 Elongation factor 4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=lepA PE=3 SV=1 465 971 2.0E-30
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 464 976 2.0E-30
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 461 884 2.0E-30
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 462 989 2.0E-30
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 462 979 2.0E-30
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 462 979 2.0E-30
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 462 979 2.0E-30
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 462 956 2.0E-30
sp|Q6AEB5|LEPA_LEIXX Elongation factor 4 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=lepA PE=3 SV=1 461 961 2.0E-30
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 464 983 2.0E-30
sp|Q4FNH3|LEPA_PELUB Elongation factor 4 OS=Pelagibacter ubique (strain HTCC1062) GN=lepA PE=3 SV=1 462 966 2.0E-30
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 461 884 2.0E-30
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 463 986 2.0E-30
sp|Q21IH3|LEPA_SACD2 Elongation factor 4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lepA PE=3 SV=1 464 908 2.0E-30
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 464 979 2.0E-30
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 462 869 2.0E-30
sp|Q6LMS0|LEPA_PHOPR Elongation factor 4 OS=Photobacterium profundum GN=lepA PE=3 SV=1 462 977 2.0E-30
sp|B1I6E0|LEPA_DESAP Elongation factor 4 OS=Desulforudis audaxviator (strain MP104C) GN=lepA PE=3 SV=1 462 960 2.0E-30
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 464 956 2.0E-30
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 464 958 2.0E-30
sp|A2QU25|GUF1_ASPNC Translation factor guf1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=guf1 PE=3 SV=1 462 951 2.0E-30
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 463 971 3.0E-30
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 463 966 3.0E-30
sp|A2SDH0|LEPA_METPP Elongation factor 4 OS=Methylibium petroleiphilum (strain PM1) GN=lepA PE=3 SV=1 462 976 3.0E-30
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 459 976 3.0E-30
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 462 960 3.0E-30
sp|Q7NAT2|LEPA_MYCGA Elongation factor 4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lepA PE=3 SV=2 462 977 3.0E-30
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 457 987 3.0E-30
sp|A9ADE0|LEPA_BURM1 Elongation factor 4 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lepA PE=3 SV=1 462 979 3.0E-30
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 463 869 3.0E-30
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 464 956 3.0E-30
sp|A4J080|LEPA_FRATW Elongation factor 4 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lepA PE=3 SV=1 462 986 3.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2642 0.1415 0.0669 0.0404 0.7577 0.1076 0.1078 0.0331 0.0401 0.0148

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup10584
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|236100
Agaricus bisporus var bisporus H39 AgabiH39|511200
Agaricus bisporus var bisporus H97 AgabiH97|028070 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028070
MIFFKTSLALTADPTSGVLREPSQLSATPKLATRTEHYRIDTNQGFQLLKHVARVPIRFPGPFKNGCTTVSVEAR
FTPQPHFGSSGMTADTPMTSFDNAPSVLAEWNSLSEEAQIKEQEDLTEYLKNPDTLTKFIEACRDIRRTVDVDIE
GGFRVVFHNLLGFVGRYGEDFPAVERRYVHGWVRLIDSWKETVRSSMNFASETVAALTDYGINLELIADINSAAD
LMRSQRELKAYMEKRPIAISTRVADGFKEFVNDVRRFSTDFTHYLEQQRQQLTTDAKQFEADIRKFQNKIADCVL
LNGKIKDASTALSVTIFVFLVAAIPAGYLIKYKRQREEALANLKEAQAGLAKTVGKQVALAAIQADVEKFKPDID
DLCGNFGVLASIWAFATEQSIEINIALQEGTHVITTKKFKAKLALLMAQIEPLKEGLREYAVNFGCHRLPRSFRF
RSFATATSFSPERIRNIAIIAHVDHGKTTLVDQLLRQSGTLTSELPSSASPGDVLATRVMDSNDLERERGITILS
KCTSINFQGNLINIVDTPGHADFGGEVERIMSMVDGVALIVDATEGPMTQTRFVLSKALSRGLRPLVVVNKVDRQ
TSRVPQVESDLFDLFATLGATDEQAEYPLLYASAKQGWASTTMTPSSTSMGPLFDLILSHVPAPTHLPTTDPFSM
LSVQLEHDPYLGLLHLGRIHSGTLAVNDTIWAIDSEGKKIGEGKVKKILIRKGLEREERDVAGAGEIVSIAGIKG
LSEDVVVGVNATLIRPDGWDEKGLQPLPTTPIDPPTISIMIHPNDSPFSGKEGTKLTSQLIRQRLLKESQTNIAL
KVLPGPTAESLEIRGRGVLHLGVLLETLRREGFELCVGAPKAVFIRDEEHPGQWLEPVEECNIIVKEQYAGTVVE
KLTLRKGTLVSYDPSSDDFVKITVHIPSRGLLSYLAGEFKTDVHGQGTLNHIFKGYEPVKQGLIANTGRGDKGSL
VSMVNGVSSGYAMAPLQARGVMFIEPNTQVYPGMIIGECNKPQTLHVNPCLKKQLTNFRTVMADDKLVLGSPRFM
GLEEMLSYMSEEEMVEITPKSIRLRKTDLEGKGRRRG*
Coding >AgabiH97|028070
ATGATCTTTTTTAAAACATCACTAGCTTTGACAGCAGATCCGACATCTGGAGTGCTTAGAGAACCCTCCCAACTT
TCTGCCACTCCGAAGCTTGCCACTCGCACTGAGCATTACAGAATTGATACCAACCAAGGGTTTCAACTTCTAAAG
CACGTTGCCCGGGTACCGATTCGATTTCCCGGACCATTTAAAAATGGATGTACCACTGTGTCCGTCGAAGCACGC
TTTACACCTCAACCCCATTTCGGATCTTCTGGCATGACTGCCGACACTCCTATGACTTCTTTTGATAATGCGCCC
AGCGTGTTGGCCGAGTGGAATTCTCTTTCTGAAGAGGCTCAGATCAAAGAGCAAGAAGATTTGACAGAATATCTG
AAGAACCCGGATACATTGACAAAGTTTATCGAGGCGTGCAGGGATATCCGTAGGACGGTTGATGTTGACATCGAA
GGTGGTTTTAGGGTTGTTTTCCATAATTTGCTTGGTTTTGTCGGGAGATATGGTGAGGATTTTCCTGCGGTCGAA
AGGAGATACGTACACGGATGGGTTAGGCTCATAGATTCTTGGAAAGAGACCGTCCGATCATCGATGAATTTTGCG
TCAGAGACTGTGGCTGCATTAACTGACTATGGTATCAATCTCGAGCTCATCGCAGATATCAACTCCGCAGCTGAC
TTGATGCGATCGCAAAGAGAGCTGAAAGCCTACATGGAAAAACGTCCGATAGCTATCTCGACAAGAGTCGCAGAC
GGATTCAAGGAATTTGTAAACGACGTTCGACGATTCTCGACAGATTTTACGCACTACCTAGAGCAACAGAGGCAA
CAACTAACGACAGATGCGAAACAATTTGAGGCTGATATCAGAAAGTTTCAAAATAAAATTGCTGATTGCGTCCTT
CTCAATGGCAAGATCAAGGACGCTTCTACAGCGTTGAGTGTTACCATCTTCGTGTTTCTTGTTGCCGCCATTCCA
GCTGGGTACCTTATTAAGTATAAGCGTCAGCGAGAGGAGGCACTAGCCAACCTTAAGGAAGCACAAGCTGGGCTC
GCCAAAACGGTCGGTAAACAGGTGGCGTTGGCAGCCATACAGGCAGACGTCGAGAAGTTCAAACCTGATATCGAT
GACCTTTGTGGCAATTTTGGCGTTCTTGCTAGTATATGGGCTTTTGCTACGGAGCAATCCATTGAGATCAATATT
GCGCTTCAGGAAGGAACACATGTAATCACGACCAAGAAATTCAAAGCGAAACTTGCGCTTCTCATGGCACAAATT
GAACCGCTCAAGGAGGGTTTGAGAGAATACGCTGTAAATTTCGGCTGCCATCGCCTGCCTCGCAGCTTCCGTTTC
CGCTCGTTTGCAACCGCAACTTCGTTTTCTCCAGAACGCATCCGTAATATTGCCATCATCGCCCATGTTGATCAT
GGAAAAACAACCCTCGTAGACCAACTCCTTCGGCAATCCGGCACTCTCACTTCCGAACTTCCGTCTTCCGCCTCT
CCTGGCGATGTTCTGGCCACCCGTGTCATGGATTCCAATGACCTCGAACGCGAACGTGGCATCACCATCTTGTCC
AAATGTACCAGTATCAATTTTCAGGGAAATCTGATTAATATTGTGGATACGCCTGGACACGCGGATTTTGGTGGA
GAAGTCGAGAGGATTATGAGTATGGTGGACGGCGTGGCGTTGATTGTCGATGCTACCGAAGGTCCAATGACTCAG
ACGCGCTTTGTGTTGAGTAAAGCTCTCAGTCGAGGTTTACGGCCATTGGTGGTTGTGAACAAAGTCGATAGACAG
ACGTCGCGTGTGCCTCAGGTGGAAAGTGATTTGTTTGATCTTTTTGCTACGCTGGGTGCTACAGACGAACAGGCC
GAGTATCCGCTGCTCTACGCGTCAGCAAAACAGGGCTGGGCGTCGACCACTATGACTCCCTCCTCAACCTCCATG
GGACCTCTCTTTGACCTCATCCTCTCCCACGTCCCTGCCCCGACTCATCTCCCTACCACCGATCCTTTCTCCATG
CTCTCAGTCCAACTCGAACACGATCCATACCTCGGTCTTTTGCATCTCGGCCGTATCCATAGTGGTACTCTCGCG
GTCAATGATACCATCTGGGCTATCGATTCGGAAGGAAAGAAAATTGGGGAAGGGAAAGTGAAAAAGATTTTGATT
AGGAAGGGATTGGAAAGGGAGGAGAGGGATGTGGCTGGCGCGGGCGAAATCGTGTCTATTGCCGGGATTAAAGGG
CTGAGTGAGGACGTCGTGGTGGGTGTTAATGCGACTCTCATTCGTCCCGATGGATGGGACGAGAAAGGTCTTCAA
CCCTTGCCCACGACGCCGATAGACCCGCCGACAATTTCAATCATGATCCACCCGAACGACTCGCCCTTTTCAGGA
AAAGAAGGCACAAAACTTACCTCCCAACTCATCCGCCAACGTCTCCTCAAAGAATCCCAAACCAACATCGCTTTA
AAAGTCCTTCCCGGACCCACTGCCGAATCCCTCGAAATCCGCGGTCGCGGCGTCTTACATCTCGGCGTCTTACTT
GAGACGCTTCGTCGAGAAGGATTTGAACTCTGTGTAGGGGCGCCGAAAGCGGTATTTATCCGTGATGAAGAACAT
CCTGGACAATGGTTAGAACCAGTCGAAGAATGCAACATCATCGTCAAAGAACAGTATGCCGGGACAGTAGTCGAA
AAACTCACTCTCCGCAAAGGAACTTTAGTTTCATATGATCCGTCTTCCGACGATTTTGTGAAAATCACGGTGCAT
ATCCCTTCGAGAGGGTTACTGTCGTATTTGGCGGGAGAATTTAAGACGGATGTACATGGGCAGGGGACGTTGAAT
CATATTTTCAAGGGGTATGAGCCGGTGAAGCAGGGATTGATTGCGAATACGGGGAGAGGGGACAAGGGGAGTTTG
GTTTCGATGGTGAATGGTGTGAGTTCGGGGTATGCTATGGCACCGTTACAGGCGAGAGGTGTGATGTTTATTGAA
CCTAATACTCAAGTATACCCGGGAATGATCATAGGCGAATGTAACAAACCACAGACGTTGCATGTCAATCCGTGT
TTGAAAAAACAATTGACAAATTTTAGGACGGTGATGGCGGATGATAAGCTTGTGTTGGGGTCGCCGAGGTTCATG
GGCTTGGAGGAAATGTTGAGCTATATGAGTGAGGAGGAAATGGTGGAGATTACGCCCAAGAGTATAAGGTTGAGG
AAGACTGACTTGGAGGGAAAGGGAAGGAGGAGAGGGTGA
Transcript >AgabiH97|028070
ATGATCTTTTTTAAAACATCACTAGCTTTGACAGCAGATCCGACATCTGGAGTGCTTAGAGAACCCTCCCAACTT
TCTGCCACTCCGAAGCTTGCCACTCGCACTGAGCATTACAGAATTGATACCAACCAAGGGTTTCAACTTCTAAAG
CACGTTGCCCGGGTACCGATTCGATTTCCCGGACCATTTAAAAATGGATGTACCACTGTGTCCGTCGAAGCACGC
TTTACACCTCAACCCCATTTCGGATCTTCTGGCATGACTGCCGACACTCCTATGACTTCTTTTGATAATGCGCCC
AGCGTGTTGGCCGAGTGGAATTCTCTTTCTGAAGAGGCTCAGATCAAAGAGCAAGAAGATTTGACAGAATATCTG
AAGAACCCGGATACATTGACAAAGTTTATCGAGGCGTGCAGGGATATCCGTAGGACGGTTGATGTTGACATCGAA
GGTGGTTTTAGGGTTGTTTTCCATAATTTGCTTGGTTTTGTCGGGAGATATGGTGAGGATTTTCCTGCGGTCGAA
AGGAGATACGTACACGGATGGGTTAGGCTCATAGATTCTTGGAAAGAGACCGTCCGATCATCGATGAATTTTGCG
TCAGAGACTGTGGCTGCATTAACTGACTATGGTATCAATCTCGAGCTCATCGCAGATATCAACTCCGCAGCTGAC
TTGATGCGATCGCAAAGAGAGCTGAAAGCCTACATGGAAAAACGTCCGATAGCTATCTCGACAAGAGTCGCAGAC
GGATTCAAGGAATTTGTAAACGACGTTCGACGATTCTCGACAGATTTTACGCACTACCTAGAGCAACAGAGGCAA
CAACTAACGACAGATGCGAAACAATTTGAGGCTGATATCAGAAAGTTTCAAAATAAAATTGCTGATTGCGTCCTT
CTCAATGGCAAGATCAAGGACGCTTCTACAGCGTTGAGTGTTACCATCTTCGTGTTTCTTGTTGCCGCCATTCCA
GCTGGGTACCTTATTAAGTATAAGCGTCAGCGAGAGGAGGCACTAGCCAACCTTAAGGAAGCACAAGCTGGGCTC
GCCAAAACGGTCGGTAAACAGGTGGCGTTGGCAGCCATACAGGCAGACGTCGAGAAGTTCAAACCTGATATCGAT
GACCTTTGTGGCAATTTTGGCGTTCTTGCTAGTATATGGGCTTTTGCTACGGAGCAATCCATTGAGATCAATATT
GCGCTTCAGGAAGGAACACATGTAATCACGACCAAGAAATTCAAAGCGAAACTTGCGCTTCTCATGGCACAAATT
GAACCGCTCAAGGAGGGTTTGAGAGAATACGCTGTAAATTTCGGCTGCCATCGCCTGCCTCGCAGCTTCCGTTTC
CGCTCGTTTGCAACCGCAACTTCGTTTTCTCCAGAACGCATCCGTAATATTGCCATCATCGCCCATGTTGATCAT
GGAAAAACAACCCTCGTAGACCAACTCCTTCGGCAATCCGGCACTCTCACTTCCGAACTTCCGTCTTCCGCCTCT
CCTGGCGATGTTCTGGCCACCCGTGTCATGGATTCCAATGACCTCGAACGCGAACGTGGCATCACCATCTTGTCC
AAATGTACCAGTATCAATTTTCAGGGAAATCTGATTAATATTGTGGATACGCCTGGACACGCGGATTTTGGTGGA
GAAGTCGAGAGGATTATGAGTATGGTGGACGGCGTGGCGTTGATTGTCGATGCTACCGAAGGTCCAATGACTCAG
ACGCGCTTTGTGTTGAGTAAAGCTCTCAGTCGAGGTTTACGGCCATTGGTGGTTGTGAACAAAGTCGATAGACAG
ACGTCGCGTGTGCCTCAGGTGGAAAGTGATTTGTTTGATCTTTTTGCTACGCTGGGTGCTACAGACGAACAGGCC
GAGTATCCGCTGCTCTACGCGTCAGCAAAACAGGGCTGGGCGTCGACCACTATGACTCCCTCCTCAACCTCCATG
GGACCTCTCTTTGACCTCATCCTCTCCCACGTCCCTGCCCCGACTCATCTCCCTACCACCGATCCTTTCTCCATG
CTCTCAGTCCAACTCGAACACGATCCATACCTCGGTCTTTTGCATCTCGGCCGTATCCATAGTGGTACTCTCGCG
GTCAATGATACCATCTGGGCTATCGATTCGGAAGGAAAGAAAATTGGGGAAGGGAAAGTGAAAAAGATTTTGATT
AGGAAGGGATTGGAAAGGGAGGAGAGGGATGTGGCTGGCGCGGGCGAAATCGTGTCTATTGCCGGGATTAAAGGG
CTGAGTGAGGACGTCGTGGTGGGTGTTAATGCGACTCTCATTCGTCCCGATGGATGGGACGAGAAAGGTCTTCAA
CCCTTGCCCACGACGCCGATAGACCCGCCGACAATTTCAATCATGATCCACCCGAACGACTCGCCCTTTTCAGGA
AAAGAAGGCACAAAACTTACCTCCCAACTCATCCGCCAACGTCTCCTCAAAGAATCCCAAACCAACATCGCTTTA
AAAGTCCTTCCCGGACCCACTGCCGAATCCCTCGAAATCCGCGGTCGCGGCGTCTTACATCTCGGCGTCTTACTT
GAGACGCTTCGTCGAGAAGGATTTGAACTCTGTGTAGGGGCGCCGAAAGCGGTATTTATCCGTGATGAAGAACAT
CCTGGACAATGGTTAGAACCAGTCGAAGAATGCAACATCATCGTCAAAGAACAGTATGCCGGGACAGTAGTCGAA
AAACTCACTCTCCGCAAAGGAACTTTAGTTTCATATGATCCGTCTTCCGACGATTTTGTGAAAATCACGGTGCAT
ATCCCTTCGAGAGGGTTACTGTCGTATTTGGCGGGAGAATTTAAGACGGATGTACATGGGCAGGGGACGTTGAAT
CATATTTTCAAGGGGTATGAGCCGGTGAAGCAGGGATTGATTGCGAATACGGGGAGAGGGGACAAGGGGAGTTTG
GTTTCGATGGTGAATGGTGTGAGTTCGGGGTATGCTATGGCACCGTTACAGGCGAGAGGTGTGATGTTTATTGAA
CCTAATACTCAAGTATACCCGGGAATGATCATAGGCGAATGTAACAAACCACAGACGTTGCATGTCAATCCGTGT
TTGAAAAAACAATTGACAAATTTTAGGACGGTGATGGCGGATGATAAGCTTGTGTTGGGGTCGCCGAGGTTCATG
GGCTTGGAGGAAATGTTGAGCTATATGAGTGAGGAGGAAATGGTGGAGATTACGCCCAAGAGTATAAGGTTGAGG
AAGACTGACTTGGAGGGAAAGGGAAGGAGGAGAGGGTGA
Gene >AgabiH97|028070
ATGATCTTTTTTAAAACATCACTAGCTTTGACAGCAGATCCGACATCTGGAGTGCTTAGAGAACCCTCCCAACTT
TCTGCCACTCCGAAGCTTGCCACTCGCACTGAGCATTACAGAATTGATACCGTACGTCCGGCCCTTTTCTATTGT
GAATCGACAGTCTGCGCCGCTTTAGAACCAAGGGTTTCAACTTCTAAAGCACGTTGCCCGGGTACCGATTCGATT
TCCCGGACCATTTAAAAATGGATGTACCACTGTGTCCGTCGAAGCACGCTTTACACCTCAACCCCATTTCGGATC
TTCTGGCATGACTGCCGACACTCCTATGACTTCTTTTGATAATGCGCCCAGCGTGTTGGCCGAGTGGAATTCTCT
TTCTGAAGAGGCTCAGATCAAAGAGCAAGAAGATTTGACAGAATATCTGAAGAACCCGGATACATTGACAAAGTT
TATCGAGGCGTGCAGGGATATCCGTAGGACGGTTGATGTTGACATCGAAGGTGGTTTTAGGGTTGTTTTCCATAA
TTTGCTTGGTTTTGTCGGGAGATATGGTGAGGATTTTCCTGCGGTCGAAAGGAGATACGTACACGGATGGGTTAG
GCTCATAGATGTGAGTGAGTCTTCTACGCTTCATCATACCTCGGTATAACGTTCGTGCGTATTAGTCTTGGAAAG
AGACCGTCCGATCATCGATGAATTTTGCGTCAGAGACTGTGGCTGCATTAACTGGCAAGCCATGCTCTTATAACC
CTGCTTGTACTGACGATAACCCTGCACAGACTATGGTATCAATCTCGAGCTCATCGCAGATATCAACTCCGCAGC
TGACTTGATGCGATCGCAAAGAGAGCTGAAAGCCTACATGGTAAGTAAACCAAGAAGTTGACTTCTGTAGTATTC
AGGAGGCCATTTTCTTTCCCGCAGGAAAAACGTCCGATAGCTATCTCGACAAGAGTCGCAGACGGATTCAAGGAA
TTTGTAAACGACGTTCGACGATTCTCGACAGATTTTACGCACTACCTAGAGCAACAGAGGCAACAACTAACGACA
GATGCGAAACAATTTGAGGCTGATATCAGAAAGTTTCAAAATAAAATTGCTGATTGCGTCCTGTGCGACGGATTG
GCTTCGTGTGTTCTGAAAACCTTTTTTTTTGTTCAGTCTCAATGGCAAGGTTACATTGTTGCTCATCGCCTCGCC
AATCACTGTTTCACTCAAGACTTTTGCCTCGTTTAGATCAAGGACGCTTCTACAGCGTTGAGTGTTACCATCTTC
GTGTTTGTAGGTAAAAGCCCATTATGATCCATTTGCATCCTGCTTACAGTCTCTTCTTAGCTTGTTGCCGCCATT
CCAGCTGGGTACCTTATTAAGTATAAGCGTCAGCGAGAGGGTAAGCGCGTGCTCTACATTAAAGTTTCGAATCAG
CGTTTACGAAATCTGCACCAGAGGCACTAGCCAACCTTAAGGAAGCACAAGCTGGGCTCGCCAAAACGGTCGGTA
AACAGGTGGCGTTGGCAGCCATACAGGCAGACGTCGAGAAGTTCAAACCTGATATCGATGACCTTTGTGGCAATT
TTGGCGTTCTTGCTAGTATATGGGCTTTTGTGAGTGTCTTTCAGTCCGAATATCTAACATTGATAACTTGACCAG
GCTACGGAGCAATCCATTGAGATCAATATTGCGCTTCAGGAAGGAACACATGTAATCACGACCAAGGTGAGACCG
ATAATCTTTCGCTCGTTGGATAGTAACATTGATTTGACCTCGTACAGAAATTCAAAGCGAAACTTGCGCTTCTCA
TGGCACAAATTGAACCGCTCAAGGAGGGTTTGAGAGAATACGCTGGTGGGATTGCATAAAGTGGAGGAGTTTGCG
TATGTAGTGGCATGTTCACGTGATGTCAAGTAAATTTCGGCGTGCGTTTGTAGACGCGTCGGTCAGTTAGTTGCG
AATGCTGAGGAGTGTTTTGCAGTGCCATCGCCTGCCTCGCAGCTTCCGTTTCCGCTCGTTTGCAACCGCAACTTC
GTTTTCTCCAGAACGCATCCGTAATATTGCCATCATCGCCCATGGTAACTTTCTCCCAAATGTTGTGACAGTTGT
TCTCATTTTCTTTCACCAGTTGATCATGGAAAAACAACCCTCGTAGACCAACTCCTTCGGCAATCCGGCACTCTC
ACTTCCGAACTTCCGTCTTCCGCCTCTCCTGGCGATGTTCTGGCCACCCGTGTCATGGATTCCAATGACCTCGAA
CGCGAACGTGGCATCACCATCTTGTCCAAATGTACCAGTATCAATTTTCAGGGAAATCTGATTAATATTGTGGAT
ACGCCTGGACACGCGGATTTTGGTGGAGAAGTCGAGAGGATTATGAGTATGGTGGACGGCGTGGCGTTGATTGTC
GATGCTACCGAAGGTCCAATGACTCAGACGCGCTTTGTGTTGAGTAAAGCTCTCAGTCGAGGTTTACGGTAATGC
GCGCTTTAACCAGTCCTTCACCTCCTTTGCTGAATTTATTTGTAGGCCATTGGTGGTTGTGAACAAAGTCGATAG
ACAGACGTCGCGTGTGCCTCAGGTGGAAAGTGATTTGTTTGATCTTTTTGCTACGCTGGGTGCTACAGACGAACA
GGCCGAGTATCCGCTGCTCTACGCGTCAGCAAAACAGGGCTGGGCGTCGACCACTATGACTCCCTCCTCAACCTC
CATGGGACCTCTCTTTGACCTCATCCTCTCCCACGTCCCTGCCCCGACTCATCTCCCTACCACCGATCCTTTCTC
CATGCTCTCAGTCCAACTCGAACACGATCCATACCTCGGTCTTTTGCATCTCGGCCGTATCCATAGTGGTACTCT
CGCGGTCAATGATACCATCTGGGCTATCGATTCGGAAGGAAAGAAAATTGGGGAAGGGAAAGTGAAAAAGATTTT
GATTAGGAAGGGATTGGAAAGGGAGGAGAGGGATGTGGCTGGCGCGGGCGAAATCGTGTCTATTGCCGGGATTAA
AGGGCTGAGTGAGGACGTCGTGGTGGGTGTTAATGCGACTCTCATTCGTCCCGATGGATGGGACGAGAAAGGTCT
TCAACCCTTGCCCGTATGTCTCTCCTTCTATTTTCGCCCATATATTAATGTCATAGTAGACGACGCCGATAGACC
CGCCGACAATTTCAATCATGATCCACCCGAACGACTCGCCCTTTTCAGGAAAAGAAGGCACAAAACTTACCTCCC
AACTCATCCGCCAACGTCTCCTCAAAGAATCCCAAACCAACATCGCTTTAAAAGTCCTTCCCGGACCCACTGCCG
AATCCCTCGAAATCCGCGGTCGCGGCGTCTTACATCTCGGCGTCTTACTTGAGACGCTTCGTCGAGAAGGATTTG
AACTCTGTGTAGGGGCGCCGAAAGCGGTATTTATCCGTGATGAAGAACATCCTGGACAATGGTTAGAACCAGTCG
AAGAATGCAACATCATCGTCAAAGAACAGTATGCCGGGACAGTAGTCGAAAAACTCACTCTCCGCAAAGGAACTT
TAGTTTCATATGATCCGTCTTCCGACGATTTTGTGAAAATCACGGTGCATATCCCTTCGAGAGGGTTACTGTCGT
ATTTGGCGGGAGAATTTAAGACGGATGTACATGGGCAGGGGACGTTGAATCATATTTTCAAGGGGTATGAGCCGG
TGAAGCAGGGATTGATTGCGAATACGGGGAGAGGGGACAAGGGGAGTTTGGTTTCGATGGTGAATGGTGTGAGTT
CGGGGTATGCTATGGCACCGTTACAGGCGAGAGGTGTGATGTTTATTGAACCTAATACTCAAGGTGCGTTTCTTC
ATCGTCGTCTTTCTTATTCTTATTTATTTCTTTATTTTAGTATACCCGGGAATGATCATAGGCGAATGTAACAAA
CCACAGACGTTGCATGTCAATCCGTGTTTGAAAAAACAATTGACAAATTTTAGGACGGTGATGGCGGATGATAAG
CTTGTGTTGGGGTCGCCGAGGTTCATGGGCTTGGAGGAAATGTTGAGCTATATGAGTGAGGAGGAAATGGTGGAG
ATTACGCCCAAGAGTATAAGGTTGAGGAAGACTGACTTGGAGGGAAAGGGAAGGAGGAGAGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail