Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|028000
Gene name
Locationscaffold_11:1679202..1681095
Strand-
Gene length (bp)1893
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 6.1E-28 61 198
PF08031 BBE Berberine and berberine like 1.3E-14 457 501

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 8 500 6.0E-26
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 38 500 6.0E-25
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 5 500 5.0E-23
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 24 254 3.0E-22
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 37 500 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 8 500 6.0E-26
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 38 500 6.0E-25
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 5 500 5.0E-23
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 24 254 3.0E-22
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 37 500 2.0E-21
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 19 500 1.0E-19
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 43 500 5.0E-19
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 19 500 4.0E-18
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 60 500 8.0E-18
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 50 500 2.0E-17
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 43 500 6.0E-17
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 39 288 4.0E-13
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 72 500 1.0E-10
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 9 231 4.0E-10
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 72 500 5.0E-10
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 72 500 1.0E-09
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 72 500 2.0E-09
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 9 225 4.0E-09
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 68 500 6.0E-09
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 60 225 7.0E-09
sp|Q0PCD7|AKNOX_STRGJ Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus GN=aknOx PE=1 SV=1 53 503 8.0E-09
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 12 241 1.0E-08
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 21 228 1.0E-07
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 22 501 3.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 27 290 3.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 4 239 5.0E-06
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 43 239 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|028000
MSITSLGLSIYLLLLSTCFMICDAQNLVADLKSQGIELVAPGDQGYNSASAAFNRRFVYKPAVVTFPTTPAQVSS
IVKTAVKYKKHVAARGGGHSYVANGLGGQNGAVVIDMNRHFTHIQVNNQANTAKIDSGSRLGDIALTLNNHGRGF
GHGTCPYVGIGGHSLFGGFAYASRLWGMVVDVIESIDLVLANGTITTASKTKNSELFWGMRGAGPSFGITTSMTI
KTFAVPPSATVFQYTWDLNATSAASFLNAYQTFSLGQVPPQFGSELVLSKGSRQGRVSITLQGVWYDAANKFDAI
IRPLVTKVGQKPRNQMVKAGKYIDSVAFFGESNNRLNTTNAPDSFDTFYVKSLLTPESQPMTTKSSQAFMQYLAN
QGFQSQSAWFIEVEEFGGPGSLVNAVPLDSTSFGNRGALFLMQFYVYESNPNNPFAQSGFSLADGMVNSVTSKNP
SNWPYTAYPNYLDNRLQNWQQLYYGQHYPRLQRLKGSVDPGNVFQFPTSIEKP*
Coding >AgabiH97|028000
ATGAGTATCACCTCACTCGGCTTGTCCATTTACCTCCTACTTCTATCTACTTGTTTTATGATATGCGACGCTCAG
AACTTAGTCGCTGATCTTAAGAGCCAGGGTATCGAGCTTGTTGCACCAGGAGACCAAGGCTACAATTCGGCGAGT
GCTGCATTCAACCGAAGATTTGTCTATAAACCAGCCGTCGTCACGTTCCCTACAACGCCTGCACAAGTTTCGAGC
ATCGTTAAAACTGCGGTCAAGTATAAAAAACACGTAGCCGCGCGAGGTGGAGGTCACAGCTATGTTGCTAATGGA
TTAGGAGGTCAAAATGGCGCCGTCGTTATCGATATGAACAGACATTTTACCCACATTCAAGTCAACAATCAGGCT
AACACGGCAAAAATCGATTCCGGAAGTCGGCTCGGCGATATTGCGTTAACATTAAACAATCATGGACGGGGTTTC
GGGCATGGAACATGTCCCTATGTAGGCATCGGCGGGCATTCCTTATTCGGAGGCTTCGCTTACGCATCGAGGTTG
TGGGGTATGGTGGTAGACGTGATAGAATCAATCGATCTCGTGCTGGCAAATGGCACGATCACCACTGCCTCAAAA
ACTAAAAATTCAGAGCTATTCTGGGGGATGCGTGGCGCTGGTCCTTCATTTGGAATTACGACATCGATGACTATC
AAAACCTTTGCCGTTCCCCCATCTGCGACTGTTTTCCAATATACATGGGACTTGAACGCGACCAGCGCGGCTTCG
TTCCTCAATGCATACCAAACATTCTCACTCGGTCAAGTTCCACCTCAATTTGGGTCGGAATTGGTCTTGTCAAAA
GGTAGTAGACAAGGCCGAGTCAGCATTACGCTTCAAGGTGTCTGGTACGATGCTGCGAACAAATTCGATGCAATC
ATCCGTCCACTTGTCACCAAAGTCGGTCAGAAACCCAGGAACCAGATGGTCAAGGCTGGAAAGTATATTGATAGC
GTTGCGTTCTTCGGTGAAAGCAACAACAGGTTGAACACGACCAATGCTCCTGATTCATTCGATACATTCTATGTC
AAGTCACTGTTGACTCCTGAAAGTCAACCGATGACGACTAAAAGTTCCCAAGCTTTTATGCAGTATCTCGCGAAC
CAGGGATTTCAATCTCAATCCGCATGGTTTATCGAAGTTGAAGAGTTTGGGGGACCTGGATCACTTGTGAACGCG
GTACCCCTTGACAGCACGTCATTCGGGAACAGAGGAGCGCTCTTTTTGATGCAATTTTACGTTTATGAGAGTAAT
CCGAATAACCCCTTTGCTCAATCTGGGTTTTCGTTAGCCGATGGCATGGTGAACAGCGTCACCAGCAAAAACCCC
TCAAACTGGCCTTATACCGCCTATCCGAATTACCTCGACAACAGGCTACAGAATTGGCAACAATTGTATTATGGT
CAACATTACCCGCGCCTTCAACGACTGAAAGGAAGTGTGGATCCGGGTAACGTTTTCCAGTTCCCAACTTCGATT
GAAAAGCCATGA
Transcript >AgabiH97|028000
ATGAGTATCACCTCACTCGGCTTGTCCATTTACCTCCTACTTCTATCTACTTGTTTTATGATATGCGACGCTCAG
AACTTAGTCGCTGATCTTAAGAGCCAGGGTATCGAGCTTGTTGCACCAGGAGACCAAGGCTACAATTCGGCGAGT
GCTGCATTCAACCGAAGATTTGTCTATAAACCAGCCGTCGTCACGTTCCCTACAACGCCTGCACAAGTTTCGAGC
ATCGTTAAAACTGCGGTCAAGTATAAAAAACACGTAGCCGCGCGAGGTGGAGGTCACAGCTATGTTGCTAATGGA
TTAGGAGGTCAAAATGGCGCCGTCGTTATCGATATGAACAGACATTTTACCCACATTCAAGTCAACAATCAGGCT
AACACGGCAAAAATCGATTCCGGAAGTCGGCTCGGCGATATTGCGTTAACATTAAACAATCATGGACGGGGTTTC
GGGCATGGAACATGTCCCTATGTAGGCATCGGCGGGCATTCCTTATTCGGAGGCTTCGCTTACGCATCGAGGTTG
TGGGGTATGGTGGTAGACGTGATAGAATCAATCGATCTCGTGCTGGCAAATGGCACGATCACCACTGCCTCAAAA
ACTAAAAATTCAGAGCTATTCTGGGGGATGCGTGGCGCTGGTCCTTCATTTGGAATTACGACATCGATGACTATC
AAAACCTTTGCCGTTCCCCCATCTGCGACTGTTTTCCAATATACATGGGACTTGAACGCGACCAGCGCGGCTTCG
TTCCTCAATGCATACCAAACATTCTCACTCGGTCAAGTTCCACCTCAATTTGGGTCGGAATTGGTCTTGTCAAAA
GGTAGTAGACAAGGCCGAGTCAGCATTACGCTTCAAGGTGTCTGGTACGATGCTGCGAACAAATTCGATGCAATC
ATCCGTCCACTTGTCACCAAAGTCGGTCAGAAACCCAGGAACCAGATGGTCAAGGCTGGAAAGTATATTGATAGC
GTTGCGTTCTTCGGTGAAAGCAACAACAGGTTGAACACGACCAATGCTCCTGATTCATTCGATACATTCTATGTC
AAGTCACTGTTGACTCCTGAAAGTCAACCGATGACGACTAAAAGTTCCCAAGCTTTTATGCAGTATCTCGCGAAC
CAGGGATTTCAATCTCAATCCGCATGGTTTATCGAAGTTGAAGAGTTTGGGGGACCTGGATCACTTGTGAACGCG
GTACCCCTTGACAGCACGTCATTCGGGAACAGAGGAGCGCTCTTTTTGATGCAATTTTACGTTTATGAGAGTAAT
CCGAATAACCCCTTTGCTCAATCTGGGTTTTCGTTAGCCGATGGCATGGTGAACAGCGTCACCAGCAAAAACCCC
TCAAACTGGCCTTATACCGCCTATCCGAATTACCTCGACAACAGGCTACAGAATTGGCAACAATTGTATTATGGT
CAACATTACCCGCGCCTTCAACGACTGAAAGGAAGTGTGGATCCGGGTAACGTTTTCCAGTTCCCAACTTCGATT
GAAAAGCCATGA
Gene >AgabiH97|028000
ATGAGTATCACCTCACTCGGCTTGTCCATTTACCTCCTACTTCTATCTACTTGTTTTATGATATGCGACGCTCAG
AACTTAGTCGCTGATCTTAAGAGCCAGGGTATCGAGCTTGTTGCACCAGGAGACCAAGGCTACAATTCGGCGAGT
GCTGCATGTGAGTTTCAAAGATCCTATAATATCGGCCCCAAATCCTGAAGCCTGTTGCAGTCAACCGAAGATTTG
TCTATAAACCAGCCGTCGTCACGTTCCCTACAACGCCTGCACAAGTTTCGAGCATCGTTAAAACTGCGGTCAAGT
ATAAAAAACACGTAGCCGCGCGAGGTGGAGGTGTAAGTACCAATATTGTATAATATCTCTCGCAGGCTGAACATT
TGGGCCATAGCACAGCTATGTTGCTAATGGATTAGGAGGTCAAAATGGCGCCGTCGTTATCGATATGAACAGACA
TTTTACCCACATTCAAGTCAACAATCAGGCTAACACGGCAAAAATCGATTCCGGAAGTCGGCTCGGCGATATTGC
GTTAACATTAAACAATCATGGACGGGGTTTCGGGCATGGAACATGTCCCTATGTAGGCATCGGCGGGCATTCCTT
ATTCGGAGGCTTCGCTTACGCATCGAGGTTGTGGGGTATGGTGGTAGACGTGATAGAATCAATCGATCTCGTGCT
GGCAAATGGCACGATCACCACTGCCTCAAAAACTAAAAATTCAGAGCTATTCTGGGTGAGTAACTTGATCCTGGT
CTAGGTTTTTTTATATATATCTGAAACGAACTTAATCAAGGGGATGCGTGGCGCTGGTCCTTCATTTGGAATTAC
GACATCGATGACTATCAAAACCTTTGCCGTTCCCCCATCTGCGACTGTTTTCCAATATACATGGGACTTGAACGC
GACCAGCGCGGCTTCGTTCCTCAATGCATACCAAACATTCTCACTCGGTCAAGTTCCACCTCAATTTGGGTCGGA
ATTGGTCTTGTCAAAAGGTAGTAGACAAGGCCGAGTCAGCATTACGCTTCAAGGTGTCTGGTACGATGCTGCGAA
CAAATTCGATGCAATCATCCGTCCACTTGTCACCAAAGTCGGTCAGAAACCCAGGAACCAGATGGTCAAGGCTGG
AAAGTATATTGATAGCGTTGCGTTCTTCGGTGAAAGCAACAACAGGTTGAACACGACCAATGCTCCTGATTCATT
CGATACATTCTATGTCAAGTCACTGTTGACTCCTGAAAGTCAACCGATGACGACTAAAAGTTCCCAAGCTTTTAT
GCAGTATCTCGCGAACCAGGGATTTCAATCTCAATCCGTGAGTGAACTTCATACAACTTCAAGGAGTAGACAACT
GATATAGTCATCTCGTACAGGCATGGTTTATCGAAGTTGAAGAGTTTGGGGGACCTGGATCACTTGTGAACGCGG
TACCCCTTGACAGCACGTCATTCGGGAACAGAGGAGCGCTCTTTTTGATGCAATTTTACGTTTATGAGAGTAATC
CGAATAACCCCTTTGCTCAATCTGGGTTTTCGTTAGCCGATGGTGAGTTGCGCGGATTATTTTCTCAATCTTCGC
GGACTGACTTTAACGTTTAGGCATGGTGAACAGCGTCACCAGCAAAAACCCCTCAAACTGGCCTTATACGTGAGT
TATAGAAATCTTCTCCATCGCTAGCAAGCTCATATAATGATCAGCGCCTATCCGAATTACCTCGACAACAGGCTA
CAGAATTGTTAGTAGGCCTAATGCAATTGAAGTCGCTTTTTGACTAATGCACATTCAACAGGGCAACAATTGTAT
TATGGTCAACATTACCCGCGCCTTCAACGACTGAAAGGAAGTGTGGATCCGGGTAACGTTTTCCAGTTCCCAACT
TCGATTGAAAAGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail