Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027890
Gene name
Locationscaffold_11:1641445..1647845
Strand-
Gene length (bp)6400
Transcript length (bp)6267
Coding sequence length (bp)6267
Protein length (aa) 2089

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 2.1E-65 1610 1841
PF00665 rve Integrase core domain 8.8E-13 1090 1187
PF13976 gag_pre-integrs GAG-pre-integrase domain 2.9E-08 1026 1076
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.0E-07 78 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1568 2085 6.0E-110
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1591 2087 1.0E-77
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 889 1298 1.0E-45
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1684 1994 5.0E-36
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1591 2079 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1568 2085 6.0E-110
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1591 2087 1.0E-77
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 889 1298 1.0E-45
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1684 1994 5.0E-36
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1591 2079 2.0E-33
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1591 2079 5.0E-33
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1591 2079 5.0E-33
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1591 2079 6.0E-33
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1591 2079 6.0E-33
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1591 2079 6.0E-33
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1591 2079 8.0E-33
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1591 2079 1.0E-32
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1591 2079 1.0E-32
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1591 2079 1.0E-32
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1591 2079 1.0E-32
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1591 2079 1.0E-32
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1591 2079 1.0E-32
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1591 2079 2.0E-32
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1591 2079 2.0E-32
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1591 2079 4.0E-32
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1591 2079 5.0E-32
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1591 2079 6.0E-32
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 1591 2079 7.0E-32
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1591 2079 7.0E-32
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 1591 2079 9.0E-32
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1591 2079 1.0E-31
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1591 2079 1.0E-31
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1591 2079 1.0E-31
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1591 2079 1.0E-31
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1591 2079 1.0E-31
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1591 2079 1.0E-31
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1591 2079 2.0E-31
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1591 2079 2.0E-31
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 1591 2079 2.0E-31
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1591 2079 2.0E-31
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1591 2079 3.0E-31
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1591 2079 4.0E-31
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1591 2079 5.0E-31
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1591 2079 7.0E-31
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1591 2079 8.0E-31
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1591 2079 9.0E-31
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1620 2079 9.0E-31
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1591 2079 1.0E-30
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1591 2079 1.0E-30
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1591 2079 3.0E-30
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 1591 2079 5.0E-30
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 1591 2079 2.0E-29
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 967 1349 1.0E-27
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1770 1998 1.0E-27
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1591 1987 5.0E-25
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1591 1987 6.0E-25
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1591 1925 4.0E-22
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1591 1840 3.0E-17
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 1594 1674 2.0E-12
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1152 1233 1.0E-08
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1112 1233 1.0E-08
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 1112 1233 1.0E-08
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1878 1955 1.0E-08
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1032 1233 3.0E-06
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1032 1233 3.0E-06
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1032 1233 3.0E-06
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1032 1233 3.0E-06
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1032 1233 3.0E-06
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1032 1233 3.0E-06
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1032 1233 3.0E-06
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1032 1233 3.0E-06
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1032 1233 3.0E-06
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1032 1233 3.0E-06
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1032 1233 3.0E-06
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1032 1233 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027890
MGPGWANIGTNSNALPKLSGAKNYDTWARRVKNALILIQQKDSTLTAWDVSGSTYSLPTLPTDPTELAKENAIRM
TLKLQATALIESTLPDHMIQEEFNSPSDLWAKMKLNYGVRGPTFVYERLQALTNFKVQDTQDPSGQIAEFVAICS
QITATGATLHDSLQTMILLSALPARMESTIGIILASAAKVADLTIEKARATIAAAWRNPQNLAAARFKPSGQAPR
WQNATPGTSGQNQQQQQRPYGQQQQRPQGQQQRQQAPQGAKPDDDKKRKRTRGKGKGKGKGKAAAVEASPPDYTA
ASAIAFPTIAIPPGFEAQPYDPRSPSLSAPTTRSLVHRIRNEKAAITPPTPLIGELSHTTSQSSPDEISVHSPLH
TEIIMLNIHDGNEWIDDWRHNVDYQNSIESNLNYLESVDPSADGTWLDDESREQSISVDCDRPFWALYGMPNDNI
ERTVPSNQSDDVKSITRDSSESAAHGWTTNNMGDDWNNQWLEPFSRPMDWNVEPAGSSTTSFRDAWDNANRFPID
DTSFEIPSNLSWGELIERGYSIDDINVIPFPVWESPSDDHILSGELSSNASVKIGSAIDHWLDDADNGYADMYSD
NDELSHSPPSHYSYTWSFDLRHHYDLPFSLDDVITENELPHGRTYTWIRGRYTDITYMELDIDRIAPTGALRTRD
PRLDVARTGRVTPYQTAKLNALLAWDRRLGARPIDRTALATHNEEAMRPDETPSEYHTVAEEPERRSGSPIDYAI
KEFGNSVIEEKEDGEISIHSGQDLMDNEEEINYDAENEGDSYSQVLPLNSQSITNSSFQRGDARSSSRGGPIPYG
TSQCLSQAWTQRKDLDSPSTSCNGSDINYAMELSVRNALLDNITPEFKSFIMSIRSNSDSYPIKWMLDSGASAHF
TGSLSDFSTVDRGFFGMVQTASGQLKIQGRGTVHIQHLVVDTNTGTKEVQRTKLWPVFYINGMHMRLISVGQLLR
SGLRLEANAKHLTFRDENNHAVLSGISGHFPSISAVLSRIVQEIPEAGAYATTNTDYSTWHRRLGHPSDLVLSKF
SKESLGVPPISIPRDKPVCKGCVEGKFAQKPFPTSESQGTQVLELIHSDLFELPVISYHRHKWVLTILDDYSSTA
FTVMLAHKSDAPREMTKVMTLLANSTDRKIKRLRTDRGGEYTNSALQEYLSINGIKHELSAPNVHQQNGRAERLN
RTLHEKSQAMRKHACLPDSWWGFSMTYAVYIYNRTPMQRVKWKTPYELFYGTKPDLSKIRVFGCGAYVYLPKEIR
KNKLSSRSELMIFLGYQGPNYQFMRYQNGNVIFVSPTALFDEAFLPKCDKSKPGNLERRLSNTPSRSNSSESENS
RNGGEVDFNLDPNSLNGPSTDQPPINRAPPAAPPRPPTPPQPIVPPRQQRAPSPPPRNATPGPSNQPPQQERPTW
RKRRDITPPDESEHNVRRSRRETKVPNRPDNVYGDKHPSKVLRDYERQPFLPDFEEGIQRRVPPRSDRQNARIPT
DDQADEARREEIRRQFEQASQRADEYEREHGSQLPSQFGDAPVPGEATMDEVQVLIREGGVRLNNFLFELANQIQ
TPVQFKDLTQLPAAMRKKWIDACLEELEALQKRGVYELVDLPKGRRTIKNRWVFNEKSDGRLRARLVAKGFSQIE
GIDYNELFSPVVRYETARLLLGIAALEDWDMFSVDVKTAYLYGKLDEEIYMTQPEGFTATGKENKVWRLRRALYG
LKQAGLSWWKQLTASMTEIGFVRCKSDAGVYYYRHPKTRELVVALVYVDDVAFMGKKNSQLLKELKLKFSTKWEC
RDQGVMTEFLGMQISRDRQNKKIFLHQQKYLQKVLDRFGIKSGSEETPLTKGYVFKTSDKVPNNGFRTKYQQLVG
SLMYLMIGSRPDIAFAVVKLSQHMVTPNKEHYTAGMHLLRYLNGTKNMVLEFDGNSNQGVIAYSDSDWASDPEDR
KSITGNFVTIANGTISWLSRKQKTVALSSTEAEYMAISDCSRQLVWVSQLLTEIGFEIQTPMLYGDNMGSLFWST
SEVQEKRSKHIDIRFHYIRELLEQKQINLDWIDGSKNPADVLTKNLEKVKFSLFRSMLNLKQQ*
Coding >AgabiH97|027890
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGACGCGTCAAAAACGCCTTGATCCTTATCCAACAGAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTACTTACTCGCTCCCCACCTTGCCTACCGACCCTACCGAGTTGGCAAAGGAAAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGC
CCAAGTGACCTCTGGGCTAAGATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAG
GCCCTCACAAACTTTAAGGTTCAAGACACCCAGGATCCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCA
CAGATCACTGCCACTGGGGCGACTCTTCACGACTCGCTCCAGACCATGATACTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCAGCTGCGAAAGTTGCTGATCTCACTATTGAGAAAGCGAGAGCT
ACTATCGCCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCTGGGCAGAATCAGCAGCAGCAGCAGCGTCCTTATGGACAGCAGCAGCAA
CGGCCGCAAGGCCAGCAGCAGAGGCAGCAAGCTCCGCAAGGAGCTAAACCTGATGACGATAAAAAACGCAAGAGG
ACTCGTGGCAAAGGCAAGGGCAAGGGAAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCA
GCTTCTGCGATCGCGTTTCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCC
TCTCTCTCTGCACCGACCACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCCGTGCATTCTCCCCTTCAC
ACGGAAATCATCATGTTAAACATTCATGATGGAAACGAATGGATTGATGATTGGCGTCACAACGTCGATTACCAA
AACTCGATCGAATCTAACCTGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAA
TCTCGGGAACAATCAATCTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATC
GAACGCACGGTTCCCTCGAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACAT
GGATGGACAACCAATAATATGGGCGACGACTGGAATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGG
AACGTTGAACCTGCCGGTTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCAAACCTCTCCTGGGGTGAATTAATTGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCGCCATCGGACGATCACATCCTCTCGGGTGAACTGTCGTCCAATGCC
TCTGTCAAAATCGGATCCGCCATCGATCATTGGCTGGATGACGCTGACAATGGGTATGCTGACATGTATTCGGAT
AACGATGAACTTTCACATTCCCCTCCCTCGCACTACTCGTACACCTGGTCGTTCGACCTCCGTCATCATTACGAT
CTACCGTTCTCTTTGGACGATGTAATCACGGAAAACGAACTTCCTCACGGACGAACGTACACTTGGATCCGCGGC
CGCTATACCGACATTACCTATATGGAACTCGATATAGATCGGATCGCTCCAACTGGTGCACTACGGACACGAGAC
CCACGTCTCGACGTCGCTCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCTCTCCTCGCCTGG
GACAGACGTCTCGGTGCTCGACCTATTGATAGAACTGCTCTGGCAACTCACAATGAGGAAGCAATGAGGCCCGAT
GAAACTCCATCCGAGTATCACACGGTAGCTGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATC
AAGGAATTTGGGAATTCTGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATG
GATAACGAAGAAGAAATCAACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCG
CAGTCAATTACTAATTCTTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGG
ACCAGCCAATGCCTATCTCAGGCTTGGACCCAGCGCAAGGATCTAGATAGTCCTAGTACCTCATGTAACGGTTCG
GATATAAATTATGCGATGGAATTGAGCGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCATTC
ATCATGAGCATAAGATCAAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCACTTT
ACTGGCAGTCTCTCAGACTTTTCTACAGTCGATCGAGGCTTCTTTGGGATGGTACAAACCGCCTCTGGACAATTA
AAAATCCAAGGCCGAGGAACAGTACACATCCAACACTTAGTTGTTGATACAAACACAGGAACCAAAGAAGTTCAA
AGGACTAAACTTTGGCCTGTCTTTTACATAAACGGTATGCACATGCGGCTCATCTCTGTCGGACAACTTTTACGG
TCCGGACTAAGATTAGAAGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCGGGT
ATCTCGGGACACTTTCCCAGTATTTCCGCCGTTCTTTCCAGGATCGTTCAGGAAATCCCCGAAGCTGGTGCTTAT
GCAACCACAAACACTGATTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTTGTGTTGAGTAAATTC
TCAAAAGAATCTTTGGGTGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAGGGATGTGTTGAAGGT
AAATTCGCGCAAAAACCCTTTCCCACTTCAGAAAGCCAAGGAACACAAGTTCTTGAGTTAATCCATTCGGATCTA
TTCGAACTTCCGGTAATCTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACGGCA
TTCACCGTAATGCTTGCCCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTCGCTAACTCC
ACTGATCGAAAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTACAAGAGTACTTG
TCTATCAACGGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTCAAT
AGAACATTGCATGAGAAATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATG
ACGTACGCGGTCTATATTTACAACCGCACGCCCATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTAT
GGAACCAAACCGGACTTGTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGT
AAAAACAAGCTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGA
TACCAAAACGGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAA
TCGAAACCAGGTAACCTCGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCC
AGAAATGGAGGAGAAGTCGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATT
AATAGAGCTCCACCGGCAGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATTGTGCCACCACGGCAACAAAGA
GCTCCATCACCACCTCCTCGTAATGCAACTCCCGGTCCGTCCAACCAGCCTCCACAGCAGGAACGGCCAACATGG
AGAAAACGGCGTGATATAACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTA
CCGAACCGACCAGATAACGTCTATGGGGATAAACACCCCTCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTC
TTGCCGGACTTCGAAGAAGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACC
GACGATCAAGCTGACGAAGCACGTCGCGAAGAAATTCGCAGACAATTCGAACAAGCTAGTCAACGGGCTGATGAA
TACGAACGAGAGCATGGCTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGAC
GAAGTTCAAGTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAA
ACGCCAGTCCAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAG
GAATTAGAAGCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAAT
AGATGGGTCTTTAATGAGAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATCGAG
GGAATCGACTACAACGAGCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCTGCC
CTTGAAGATTGGGATATGTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAAGAAATCTAT
ATGACGCAACCCGAAGGATTCACAGCCACCGGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTACGGC
CTTAAACAAGCCGGGTTAAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAGATCGGTTTTGTCAGATGCAAA
TCCGATGCAGGCGTGTATTATTACCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGATGAC
GTAGCTTTCATGGGAAAGAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTTTCAACCAAATGGGAATGT
CGTGATCAAGGTGTTATGACAGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTCTTG
CACCAGCAGAAGTACCTCCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTAACA
AAAGGTTACGTATTCAAAACTTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTCGGA
TCATTGATGTACCTCATGATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTATCACAGCACATGGTG
ACTCCAAATAAAGAGCACTATACTGCCGGCATGCATCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTTCTT
GAGTTTGATGGTAACTCGAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGACCGG
AAATCAATTACCGGCAACTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAAACTGTT
GCACTCTCATCGACGGAAGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCCAACTC
TTGACCGAGATTGGTTTCGAGATACAAACTCCAATGCTCTATGGAGACAATATGGGCAGTCTATTTTGGTCAACT
TCTGAAGTCCAGGAGAAACGATCGAAGCACATTGACATTCGCTTCCATTATATCCGAGAGCTCTTAGAACAGAAG
CAAATCAATCTTGATTGGATTGACGGATCAAAGAATCCTGCTGACGTTTTAACTAAAAACCTAGAAAAAGTGAAA
TTCTCTCTTTTCCGCTCTATGCTTAACTTAAAGCAACAATGA
Transcript >AgabiH97|027890
ATGGGCCCCGGTTGGGCAAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGAT
ACTTGGGCCCGACGCGTCAAAAACGCCTTGATCCTTATCCAACAGAAGGACTCCACCCTGACCGCATGGGATGTT
AGCGGCAGTACTTACTCGCTCCCCACCTTGCCTACCGACCCTACCGAGTTGGCAAAGGAAAATGCAATCAGGATG
ACTCTCAAATTGCAGGCAACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGC
CCAAGTGACCTCTGGGCTAAGATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAG
GCCCTCACAAACTTTAAGGTTCAAGACACCCAGGATCCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCA
CAGATCACTGCCACTGGGGCGACTCTTCACGACTCGCTCCAGACCATGATACTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCAGCTGCGAAAGTTGCTGATCTCACTATTGAGAAAGCGAGAGCT
ACTATCGCCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCTGGGCAGAATCAGCAGCAGCAGCAGCGTCCTTATGGACAGCAGCAGCAA
CGGCCGCAAGGCCAGCAGCAGAGGCAGCAAGCTCCGCAAGGAGCTAAACCTGATGACGATAAAAAACGCAAGAGG
ACTCGTGGCAAAGGCAAGGGCAAGGGAAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCA
GCTTCTGCGATCGCGTTTCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCC
TCTCTCTCTGCACCGACCACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCCGTGCATTCTCCCCTTCAC
ACGGAAATCATCATGTTAAACATTCATGATGGAAACGAATGGATTGATGATTGGCGTCACAACGTCGATTACCAA
AACTCGATCGAATCTAACCTGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAA
TCTCGGGAACAATCAATCTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATC
GAACGCACGGTTCCCTCGAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACAT
GGATGGACAACCAATAATATGGGCGACGACTGGAATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGG
AACGTTGAACCTGCCGGTTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCAAACCTCTCCTGGGGTGAATTAATTGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCGCCATCGGACGATCACATCCTCTCGGGTGAACTGTCGTCCAATGCC
TCTGTCAAAATCGGATCCGCCATCGATCATTGGCTGGATGACGCTGACAATGGGTATGCTGACATGTATTCGGAT
AACGATGAACTTTCACATTCCCCTCCCTCGCACTACTCGTACACCTGGTCGTTCGACCTCCGTCATCATTACGAT
CTACCGTTCTCTTTGGACGATGTAATCACGGAAAACGAACTTCCTCACGGACGAACGTACACTTGGATCCGCGGC
CGCTATACCGACATTACCTATATGGAACTCGATATAGATCGGATCGCTCCAACTGGTGCACTACGGACACGAGAC
CCACGTCTCGACGTCGCTCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCTCTCCTCGCCTGG
GACAGACGTCTCGGTGCTCGACCTATTGATAGAACTGCTCTGGCAACTCACAATGAGGAAGCAATGAGGCCCGAT
GAAACTCCATCCGAGTATCACACGGTAGCTGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATC
AAGGAATTTGGGAATTCTGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATG
GATAACGAAGAAGAAATCAACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCG
CAGTCAATTACTAATTCTTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGG
ACCAGCCAATGCCTATCTCAGGCTTGGACCCAGCGCAAGGATCTAGATAGTCCTAGTACCTCATGTAACGGTTCG
GATATAAATTATGCGATGGAATTGAGCGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCATTC
ATCATGAGCATAAGATCAAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCACTTT
ACTGGCAGTCTCTCAGACTTTTCTACAGTCGATCGAGGCTTCTTTGGGATGGTACAAACCGCCTCTGGACAATTA
AAAATCCAAGGCCGAGGAACAGTACACATCCAACACTTAGTTGTTGATACAAACACAGGAACCAAAGAAGTTCAA
AGGACTAAACTTTGGCCTGTCTTTTACATAAACGGTATGCACATGCGGCTCATCTCTGTCGGACAACTTTTACGG
TCCGGACTAAGATTAGAAGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCGGGT
ATCTCGGGACACTTTCCCAGTATTTCCGCCGTTCTTTCCAGGATCGTTCAGGAAATCCCCGAAGCTGGTGCTTAT
GCAACCACAAACACTGATTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTTGTGTTGAGTAAATTC
TCAAAAGAATCTTTGGGTGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAGGGATGTGTTGAAGGT
AAATTCGCGCAAAAACCCTTTCCCACTTCAGAAAGCCAAGGAACACAAGTTCTTGAGTTAATCCATTCGGATCTA
TTCGAACTTCCGGTAATCTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACGGCA
TTCACCGTAATGCTTGCCCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTCGCTAACTCC
ACTGATCGAAAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTACAAGAGTACTTG
TCTATCAACGGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTCAAT
AGAACATTGCATGAGAAATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATG
ACGTACGCGGTCTATATTTACAACCGCACGCCCATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTAT
GGAACCAAACCGGACTTGTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGT
AAAAACAAGCTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGA
TACCAAAACGGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAA
TCGAAACCAGGTAACCTCGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCC
AGAAATGGAGGAGAAGTCGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATT
AATAGAGCTCCACCGGCAGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATTGTGCCACCACGGCAACAAAGA
GCTCCATCACCACCTCCTCGTAATGCAACTCCCGGTCCGTCCAACCAGCCTCCACAGCAGGAACGGCCAACATGG
AGAAAACGGCGTGATATAACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTA
CCGAACCGACCAGATAACGTCTATGGGGATAAACACCCCTCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTC
TTGCCGGACTTCGAAGAAGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACC
GACGATCAAGCTGACGAAGCACGTCGCGAAGAAATTCGCAGACAATTCGAACAAGCTAGTCAACGGGCTGATGAA
TACGAACGAGAGCATGGCTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGAC
GAAGTTCAAGTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAA
ACGCCAGTCCAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAG
GAATTAGAAGCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAAT
AGATGGGTCTTTAATGAGAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATCGAG
GGAATCGACTACAACGAGCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCTGCC
CTTGAAGATTGGGATATGTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAAGAAATCTAT
ATGACGCAACCCGAAGGATTCACAGCCACCGGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTACGGC
CTTAAACAAGCCGGGTTAAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAGATCGGTTTTGTCAGATGCAAA
TCCGATGCAGGCGTGTATTATTACCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGATGAC
GTAGCTTTCATGGGAAAGAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTTTCAACCAAATGGGAATGT
CGTGATCAAGGTGTTATGACAGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTCTTG
CACCAGCAGAAGTACCTCCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTAACA
AAAGGTTACGTATTCAAAACTTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTCGGA
TCATTGATGTACCTCATGATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTATCACAGCACATGGTG
ACTCCAAATAAAGAGCACTATACTGCCGGCATGCATCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTTCTT
GAGTTTGATGGTAACTCGAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGACCGG
AAATCAATTACCGGCAACTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAAACTGTT
GCACTCTCATCGACGGAAGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCCAACTC
TTGACCGAGATTGGTTTCGAGATACAAACTCCAATGCTCTATGGAGACAATATGGGCAGTCTATTTTGGTCAACT
TCTGAAGTCCAGGAGAAACGATCGAAGCACATTGACATTCGCTTCCATTATATCCGAGAGCTCTTAGAACAGAAG
CAAATCAATCTTGATTGGATTGACGGATCAAAGAATCCTGCTGACGTTTTAACTAAAAACCTAGAAAAAGTGAAA
TTCTCTCTTTTCCGCTCTATGCTTAACTTAAAGCAACAATGA
Gene >AgabiH97|027890
ATGGGCCCCGGTTGGTGCATCTATAGATGATCGTTTGATCTCTAGACCAACCGCTTTTGGATGGACATTCTCTAG
CCCATTTAGAATAGCCTATAGATAGCATGTCATACCCTAGATCAGAGACTTACTGACCGATCTGGGTTGCAGGGC
AAATATTGGTACCAACTCCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGAACTATGATACTTGGGCCCGACGCGT
CAAAAACGCCTTGATCCTTATCCAACAGAAGGACTCCACCCTGACCGCATGGGATGTTAGCGGCAGTACTTACTC
GCTCCCCACCTTGCCTACCGACCCTACCGAGTTGGCAAAGGAAAATGCAATCAGGATGACTCTCAAATTGCAGGC
AACTGCGTTGATCGAGTCTACCCTCCCGGACCACATGATCCAGGAGGAATTCAACAGCCCAAGTGACCTCTGGGC
TAAGATGAAGTTGAATTACGGAGTCCGAGGACCGACTTTCGTCTATGAAAGGCTCCAGGCCCTCACAAACTTTAA
GGTTCAAGACACCCAGGATCCATCTGGACAAATCGCTGAGTTCGTCGCGATCTGTTCACAGATCACTGCCACTGG
GGCGACTCTTCACGACTCGCTCCAGACCATGATACTCCTCTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGG
AATCATCCTCGCTTCAGCTGCGAAAGTTGCTGATCTCACTATTGAGAAAGCGAGAGCTACTATCGCCGCGGCTTG
GCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAACCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCC
TGGAACATCTGGGCAGAATCAGCAGCAGCAGCAGCGTCCTTATGGACAGCAGCAGCAACGGCCGCAAGGCCAGCA
GCAGAGGCAGCAAGCTCCGCAAGGAGCTAAACCTGATGACGATAAAAAACGCAAGAGGACTCGTGGCAAAGGCAA
GGGCAAGGGAAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCAGCTTCTGCGATCGCGTT
TCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCCTCTCTCTCTGCACCGAC
CACACGGTCTTTGGTGCATCGTATCCGAAATGAGAAAGCAGCTATCACGCCGCCGACTCCCTTGATTGGTGAGTT
GTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCCGTGCATTCTCCCCTTCACACGGAAATCATCATGTT
AAACATTCATGATGGAAACGAATGGATTGATGATTGGCGTCACAACGTCGATTACCAAAACTCGATCGAATCTAA
CCTGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAATCTCGGGAACAATCAAT
CTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATCGAACGCACGGTTCCCTC
GAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACATGGATGGACAACCAATAA
TATGGGCGACGACTGGAATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGGAACGTTGAACCTGCCGG
TTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGATGATACGTCATTCGAAAT
CCCTTCAAACCTCTCCTGGGGTGAATTAATTGAACGGGGATATTCCATTGACGACATAAATGTCATACCATTCCC
TGTATGGGAATCGCCATCGGACGATCACATCCTCTCGGGTGAACTGTCGTCCAATGCCTCTGTCAAAATCGGATC
CGCCATCGATCATTGGCTGGATGACGCTGACAATGGGTATGCTGACATGTATTCGGATAACGATGAACTTTCACA
TTCCCCTCCCTCGCACTACTCGTACACCTGGTCGTTCGACCTCCGTCATCATTACGATCTACCGTTCTCTTTGGA
CGATGTAATCACGGAAAACGAACTTCCTCACGGACGAACGTACACTTGGATCCGCGGCCGCTATACCGACATTAC
CTATATGGAACTCGATATAGATCGGATCGCTCCAACTGGTGCACTACGGACACGAGACCCACGTCTCGACGTCGC
TCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCTCTCCTCGCCTGGGACAGACGTCTCGGTGC
TCGACCTATTGATAGAACTGCTCTGGCAACTCACAATGAGGAAGCAATGAGGCCCGATGAAACTCCATCCGAGTA
TCACACGGTAGCTGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATCAAGGAATTTGGGAATTC
TGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATGGATAACGAAGAAGAAAT
CAACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCGCAGTCAATTACTAATTC
TTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGGACCAGCCAATGCCTATC
TCAGGCTTGGACCCAGCGCAAGGATCTAGATAGTCCTAGTACCTCATGTAACGGTTCGGATATAAATTATGCGAT
GGAATTGAGCGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCATTCATCATGAGCATAAGATC
AAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCACTTTACTGGCAGTCTCTCAGA
CTTTTCTACAGTCGATCGAGGCTTCTTTGGGATGGTACAAACCGCCTCTGGACAATTAAAAATCCAAGGCCGAGG
AACAGTACACATCCAACACTTAGTTGTTGATACAAACACAGGAACCAAAGAAGTTCAAAGGACTAAACTTTGGCC
TGTCTTTTACATAAACGGTATGCACATGCGGCTCATCTCTGTCGGACAACTTTTACGGTCCGGACTAAGATTAGA
AGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCGGGTATCTCGGGACACTTTCC
CAGTATTTCCGCCGTTCTTTCCAGGATCGTTCAGGAAATCCCCGAAGCTGGTGCTTATGCAACCACAAACACTGA
TTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTTGTGTTGAGTAAATTCTCAAAAGAATCTTTGGG
TGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAGGGATGTGTTGAAGGTAAATTCGCGCAAAAACC
CTTTCCCACTTCAGAAAGCCAAGGAACACAAGTTCTTGAGTTAATCCATTCGGATCTATTCGAACTTCCGGTAAT
CTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACGGCATTCACCGTAATGCTTGC
CCACAAAAGTGATGCACCTCGAGAAATGACGAAAGTCATGACGTTGCTCGCTAACTCCACTGATCGAAAGATCAA
GAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTACAAGAGTACTTGTCTATCAACGGCATTAA
ACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTCAATAGAACATTGCATGAGAA
ATCACAAGCCATGCGCAAGCATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATGACGTACGCGGTCTATAT
TTACAACCGCACGCCCATGCAACGAGTGAAGTGGAAGACTCCGTATGAATTATTCTATGGAACCAAACCGGACTT
GTCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGTAAAAACAAGCTCTCTTC
ACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGATACCAAAACGGAAATGT
AATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAATCGAAACCAGGTAACCT
CGAAAGAAGATTGAGTAATACTCCGAGTCGAAGTAATTCCTCGGAATCAGAGAACTCCAGAAATGGAGGAGAAGT
CGATTTTAATCTCGACCCTAATTCTCTTAATGGTCCCTCTACGGATCAACCACCTATTAATAGAGCTCCACCGGC
AGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATTGTGCCACCACGGCAACAAAGAGCTCCATCACCACCTCC
TCGTAATGCAACTCCCGGTCCGTCCAACCAGCCTCCACAGCAGGAACGGCCAACATGGAGAAAACGGCGTGATAT
AACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTACCGAACCGACCAGATAA
CGTCTATGGGGATAAACACCCCTCAAAAGTTCTGAGAGATTACGAGAGACAACCTTTCTTGCCGGACTTCGAAGA
AGGAATCCAGCGAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACCGACGATCAAGCTGACGA
AGCACGTCGCGAAGAAATTCGCAGACAATTCGAACAAGCTAGTCAACGGGCTGATGAATACGAACGAGAGCATGG
CTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGACGAAGTTCAAGTTCTAAT
CAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAAACGCCAGTCCAATTTAA
GGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAGGAATTAGAAGCCTTACA
GAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAATAGATGGGTCTTTAATGA
GAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATCGAGGGAATCGACTACAACGA
GCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCTGCCCTTGAAGATTGGGATAT
GTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAAGAAATCTATATGACGCAACCCGAAGG
ATTCACAGCCACCGGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTACGGCCTTAAACAAGCCGGGTT
AAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAGATCGGTTTTGTCAGATGCAAATCCGATGCAGGCGTGTA
TTATTACCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGATGACGTAGCTTTCATGGGAAA
GAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTTTCAACCAAATGGGAATGTCGTGATCAAGGTGTTAT
GACAGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTCTTGCACCAGCAGAAGTACCT
CCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTAACAAAAGGTTACGTATTCAA
AACTTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTCGGATCATTGATGTACCTCAT
GATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTATCACAGCACATGGTGACTCCAAATAAAGAGCA
CTATACTGCCGGCATGCATCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTTCTTGAGTTTGATGGTAACTC
GAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGACCGGAAATCAATTACCGGCAA
CTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAAACTGTTGCACTCTCATCGACGGA
AGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCCAACTCTTGACCGAGATTGGTTT
CGAGATACAAACTCCAATGCTCTATGGAGACAATATGGGCAGTCTATTTTGGTCAACTTCTGAAGTCCAGGAGAA
ACGATCGAAGCACATTGACATTCGCTTCCATTATATCCGAGAGCTCTTAGAACAGAAGCAAATCAATCTTGATTG
GATTGACGGATCAAAGAATCCTGCTGACGTTTTAACTAAAAACCTAGAAAAAGTGAAATTCTCTCTTTTCCGCTC
TATGCTTAACTTAAAGCAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail