Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027490
Gene name
Locationscaffold_11:1541800..1546162
Strand-
Gene length (bp)4362
Transcript length (bp)4362
Coding sequence length (bp)4362
Protein length (aa) 1454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 4.6E-50 971 1210
PF13976 gag_pre-integrs GAG-pre-integrase domain 2.7E-10 468 541
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 8.8E-09 89 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 1452 2.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 167 1445 3.0E-134
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1050 1350 5.0E-37
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1134 1364 3.0E-33
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 357 767 7.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 88 1452 2.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 167 1445 3.0E-134
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1050 1350 5.0E-37
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1134 1364 3.0E-33
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 357 767 7.0E-20
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 357 767 7.0E-20
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 357 767 7.0E-20
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 357 767 7.0E-20
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 357 767 8.0E-20
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 357 767 8.0E-20
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 357 767 8.0E-20
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 357 767 8.0E-20
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 357 767 8.0E-20
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 357 767 8.0E-20
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 357 767 9.0E-20
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 357 767 2.0E-19
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 357 767 2.0E-19
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 357 767 5.0E-19
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 357 767 5.0E-19
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 357 767 5.0E-19
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 357 767 5.0E-19
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 357 767 6.0E-19
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 357 767 6.0E-19
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 357 767 6.0E-19
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 357 767 6.0E-19
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 357 767 6.0E-19
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 357 767 6.0E-19
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 357 767 6.0E-19
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 357 767 6.0E-19
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 357 767 6.0E-19
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 357 767 6.0E-19
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 357 767 6.0E-19
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 420 767 7.0E-19
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 357 767 7.0E-19
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 357 767 7.0E-19
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 357 767 7.0E-19
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 357 767 7.0E-19
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 357 767 7.0E-19
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 357 767 8.0E-19
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 357 767 8.0E-19
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 357 767 8.0E-19
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 956 1438 1.0E-18
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 357 767 1.0E-18
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 357 767 1.0E-18
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 357 767 1.0E-18
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 357 767 2.0E-18
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 357 767 2.0E-18
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 357 767 3.0E-18
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 357 767 4.0E-18
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 981 1438 2.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 981 1438 3.0E-17
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 981 1438 3.0E-17
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 981 1438 7.0E-17
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 981 1438 7.0E-17
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 981 1438 8.0E-17
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 981 1438 8.0E-17
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 981 1438 8.0E-17
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 981 1438 9.0E-17
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 890 1439 9.0E-17
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 981 1438 9.0E-17
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 981 1438 9.0E-17
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 981 1438 9.0E-17
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 981 1438 1.0E-16
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 981 1438 1.0E-16
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 981 1438 1.0E-16
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 981 1438 2.0E-16
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 956 1438 2.0E-16
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 956 1438 2.0E-16
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 981 1438 2.0E-16
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 981 1438 2.0E-16
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 981 1438 2.0E-16
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 981 1438 2.0E-16
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 981 1438 2.0E-16
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 956 1438 3.0E-16
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 981 1438 3.0E-16
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 981 1438 3.0E-16
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 890 1439 3.0E-16
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 981 1438 3.0E-16
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 956 1438 4.0E-16
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 981 1438 5.0E-16
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 981 1438 6.0E-16
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 981 1438 8.0E-16
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 981 1438 9.0E-16
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 981 1438 9.0E-16
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 981 1438 1.0E-15
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 981 1438 1.0E-15
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 981 1438 2.0E-15
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 981 1438 2.0E-15
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 981 1438 2.0E-15
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 956 1438 2.0E-15
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 981 1438 3.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 981 1438 4.0E-15
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 956 1438 9.0E-15
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 533 767 5.0E-13
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 355 808 6.0E-13
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 919 1040 7.0E-13
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 355 808 1.0E-12
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 355 808 2.0E-12
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 684 789 3.0E-09
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 981 1298 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027490
MFADTAKFNGMNWVTWKGLIKIAAELRGVYRYLDGSIQNPTGVVIPNPLTVPLPPSTPAEGASPTQTVTQLPPPA
DTPWESLFPSPSEWRVRNAWAMGLLIYNTSDPVGLGINISGTAADAWKSYTDTYEVVSEIAILNAELTLCNSSYA
DGQDFVEFVTQMRTKWSNATALGATIDDKSFRTIILNALPRSWDPIVATLYTTQSSREAINQLMTHWARVSRDRV
SNPQSSTTALQASNTRSNRQRTQSQLQCTNSNCKRRGHLIEDCYWPGGGKEGQFPPGFGKRGGARGTAAQNNYNQ
QTSANVTDTNPQTTEPTVFALAVVTEVNDDTLVQADPPAPNIPMSYAAIVSQPIVTLLDSGASDHCFVRRESFSN
YRKITPVRVGHSAGKGATFDIEGEGHADFFTKASDNVSKIVLAGALHTPQLRSNLISVSRLVAKGSTVKFEASSA
VVRNAAGNHVFTAVKKDGLYIVETVYPYKTSINAVQAKRKPASYEIWHRRLGHVPVNLISRMSKEDLVDGLNTSG
EPNMKALCKDCIYGKHTTHPFNDPIPPESDILERVYIDIWGPAPVVSAGGAKYFMLVMDDATSYRRVYFLPSKTA
DATLRAFRDFHDESERQTGKKLKRQTGKKLKRQTGKKLKRVRSDMGREWHNDTWNTYVKEKGIILDFSTPYAHQQ
NSKAERSMRTLLETARSMLSDSGLPQKYWADAVQTAVYTRNFIPPSNKPSTIPAERWSGKRQDVSHLRPFGSVSY
AHIPPEVSPSKLSPRSVKLTLVGYYDRSGYKLLDRGTGKVYRSRDVIFEERVPHFSTDPIVTYPVFSDVVASDPT
AIAPRPKPISNLHPTSSTNAESSEAPQAGIPQADDKEGADNEVDDSETEVARMLVEGTNTDDPPRHDAADSIAQR
RTRREPRMSRRMQESVEYLERSRANVVTVPPPTYVNDDLYVPKSFADAMRCPELWYEPMLKELAAMKDKGVYRLV
PRPKGKNVVKSRWVFANKFNDSGNISGHKARLVAKGFTQVLGEDYDETYASVARLESVRLVCAIAASFGMRLWQV
DFVSAFLNSDNEFEVFMEQPPSFEEGGDDVWLLLKTLYGTMQGAHDWARNLENTYQGHGYYTSKADPQVRSRVIH
DEFTLTSTWTDDILGASTTETGEQKAKQELGNSYELKDLGAAKFILGMKIEHDDAGNIRLSQRAYCERVIDCFHM
ADAKPRSTPLPAGLTLSTEDSPKSKEELDEMKNAPFREALGFLMWLQVATRPDLSYAVNLLSRFANNPGRKHWNA
LKHVLAYLKGTLDYRITYRRGTTIRPYGYVDADYAGDLDTSQSTEGHIFFVAGGPVSWTSKRQDTVTLSTVEAEY
TAFARATQQAIWISKFFDEVALAQDMPLNIYADNNGAISNTQNDKNHRRTKHIWVKYHFTKEKVASGEVTFTYVP
SAQNLADILTKPLAREAILRCCKGIGLF*
Coding >AgabiH97|027490
ATGTTCGCCGACACAGCGAAATTCAACGGCATGAATTGGGTAACATGGAAGGGACTCATTAAGATAGCAGCCGAG
TTGCGGGGTGTATACAGATACCTTGATGGTTCCATTCAAAATCCTACAGGCGTTGTCATACCGAATCCATTAACT
GTCCCACTACCTCCTTCTACACCTGCGGAAGGCGCATCGCCTACCCAAACGGTCACACAACTTCCCCCACCGGCA
GATACCCCATGGGAATCACTATTTCCTTCTCCATCAGAATGGAGAGTCCGGAACGCATGGGCAATGGGGTTGTTG
ATATATAACACAAGCGATCCCGTTGGGCTGGGCATTAACATCAGTGGAACAGCAGCCGACGCGTGGAAGTCATAC
ACGGACACTTACGAAGTAGTATCCGAAATTGCCATTCTCAATGCCGAATTAACCTTGTGTAACTCGTCCTATGCT
GATGGCCAAGATTTTGTGGAATTCGTAACTCAGATGCGCACTAAATGGTCAAATGCAACTGCTCTCGGCGCTACG
ATTGACGACAAGTCCTTTAGGACCATAATACTCAATGCCCTCCCTCGATCATGGGACCCAATCGTCGCTACCCTC
TACACCACTCAGTCATCTCGGGAAGCGATCAACCAACTGATGACACACTGGGCACGGGTTAGCAGGGATCGAGTT
TCCAATCCACAGAGTTCTACCACAGCGCTTCAGGCAAGCAATACGAGGAGTAATCGTCAACGTACCCAATCCCAA
CTACAATGTACCAACTCCAACTGCAAACGACGTGGCCATCTTATTGAGGACTGCTACTGGCCTGGAGGCGGCAAA
GAAGGCCAATTTCCCCCCGGTTTCGGCAAACGAGGAGGAGCTAGAGGTACCGCTGCACAGAACAACTATAACCAA
CAAACTTCAGCCAACGTGACGGATACAAACCCACAGACTACTGAACCCACCGTGTTCGCCTTAGCAGTCGTTACC
GAGGTCAACGACGATACCCTGGTACAAGCCGATCCACCCGCTCCAAACATTCCCATGTCTTATGCAGCAATCGTC
TCACAACCCATCGTCACTTTACTCGATTCGGGAGCGAGCGATCACTGCTTCGTTCGACGTGAAAGCTTCTCCAAC
TATAGAAAGATAACTCCCGTTCGCGTAGGACATTCCGCAGGGAAAGGTGCTACGTTTGACATCGAGGGTGAAGGA
CATGCGGATTTTTTTACCAAAGCCAGTGATAACGTCTCGAAGATTGTTCTTGCGGGAGCGCTCCATACGCCACAG
CTCAGATCCAACCTAATCTCTGTATCTCGACTAGTTGCCAAAGGATCCACCGTCAAATTTGAAGCTAGCTCAGCG
GTCGTTCGTAATGCTGCTGGGAACCATGTGTTTACGGCGGTGAAGAAAGATGGCTTGTATATTGTCGAAACCGTC
TATCCATACAAAACATCTATCAACGCCGTTCAGGCAAAGAGGAAACCAGCGTCTTATGAAATCTGGCACAGGCGA
CTAGGACACGTACCTGTCAATCTCATTTCGCGTATGTCGAAGGAGGATTTGGTTGACGGCTTGAACACCAGTGGG
GAACCTAACATGAAGGCTTTGTGCAAAGATTGTATATATGGAAAGCATACCACGCACCCTTTCAATGATCCCATC
CCGCCGGAATCAGACATCCTTGAACGGGTGTATATTGATATTTGGGGTCCCGCACCGGTCGTCTCAGCTGGGGGA
GCTAAATACTTCATGTTAGTGATGGATGATGCGACATCCTATCGTCGAGTCTATTTCCTCCCTTCCAAAACAGCA
GACGCAACTCTACGAGCCTTCAGGGACTTTCACGATGAGTCTGAGCGTCAGACGGGGAAGAAACTTAAGCGTCAG
ACGGGGAAGAAACTTAAGCGTCAGACGGGGAAGAAACTTAAGCGTGTACGCTCGGATATGGGGAGAGAGTGGCAT
AACGATACCTGGAACACCTATGTGAAGGAGAAGGGAATCATTCTCGATTTCTCCACGCCATACGCTCACCAACAG
AACAGTAAAGCTGAGCGCAGCATGCGCACACTACTTGAGACGGCCCGTTCCATGTTGTCCGACTCGGGTTTGCCC
CAGAAGTATTGGGCGGATGCAGTGCAAACGGCCGTCTACACTCGAAACTTTATTCCCCCATCCAATAAGCCCTCC
ACTATTCCTGCTGAGCGTTGGTCGGGGAAACGTCAAGACGTCTCCCATCTTCGTCCATTCGGTTCGGTGTCGTAT
GCGCATATACCTCCCGAAGTCAGTCCCTCAAAGCTGTCACCACGTTCTGTTAAGCTCACCTTGGTCGGTTATTAC
GATCGATCGGGTTATAAGCTGCTGGACAGAGGAACTGGGAAGGTTTATAGGTCTAGAGACGTGATATTCGAAGAA
AGGGTTCCGCATTTCTCCACTGACCCAATCGTTACGTATCCGGTTTTCTCGGATGTTGTGGCGTCCGACCCGACC
GCAATAGCTCCACGTCCTAAGCCTATATCTAACCTCCATCCCACCTCCTCCACCAACGCTGAGTCCTCCGAGGCT
CCACAGGCTGGTATCCCGCAAGCCGACGACAAGGAAGGGGCTGATAATGAGGTGGATGACAGTGAGACTGAGGTA
GCTCGTATGCTGGTGGAAGGAACCAACACGGACGACCCACCCCGACATGATGCCGCTGACTCGATAGCGCAACGT
CGTACTAGGCGAGAGCCTCGCATGAGCCGGAGGATGCAGGAGAGCGTTGAATATTTGGAACGTTCGAGGGCGAAC
GTCGTAACGGTGCCACCTCCCACCTATGTCAACGATGACTTATACGTTCCGAAATCTTTTGCAGATGCTATGAGA
TGTCCTGAGCTCTGGTATGAGCCGATGCTAAAGGAACTCGCCGCTATGAAGGACAAGGGTGTCTATCGACTAGTC
CCTCGGCCGAAGGGGAAGAACGTGGTGAAGTCTCGTTGGGTCTTTGCGAACAAGTTCAATGACTCCGGGAACATC
TCTGGGCATAAAGCACGCTTAGTGGCGAAAGGGTTTACTCAGGTCCTGGGGGAGGACTACGACGAGACCTATGCT
TCGGTGGCCCGCCTGGAGTCCGTTCGACTCGTCTGCGCTATCGCCGCCTCATTTGGTATGCGACTTTGGCAGGTG
GACTTCGTGTCTGCTTTCCTTAACAGTGATAATGAGTTCGAGGTGTTTATGGAGCAACCGCCCAGTTTTGAGGAA
GGGGGAGATGACGTCTGGCTACTCCTCAAGACCTTGTACGGTACAATGCAAGGCGCACACGATTGGGCTCGAAAC
CTCGAAAACACTTATCAAGGCCACGGGTACTATACTTCAAAGGCAGATCCCCAGGTTCGCTCGAGAGTTATACAC
GACGAGTTCACACTCACCTCCACTTGGACCGACGACATACTAGGAGCGTCTACAACAGAAACCGGCGAACAGAAA
GCTAAGCAGGAGTTGGGGAATAGTTATGAGTTGAAGGATCTAGGTGCAGCGAAGTTTATTCTGGGGATGAAGATC
GAGCATGATGACGCAGGGAATATTCGTCTTTCTCAACGAGCTTATTGCGAGAGAGTTATTGATTGTTTTCATATG
GCAGATGCGAAGCCCCGTTCAACTCCATTACCAGCTGGACTTACGCTATCCACAGAAGACTCACCCAAGTCTAAG
GAGGAGCTCGATGAGATGAAGAATGCACCGTTTCGCGAGGCGCTAGGATTCCTTATGTGGCTGCAGGTGGCCACC
CGACCTGACTTGTCATACGCGGTGAATCTACTATCTAGGTTCGCTAACAACCCAGGCAGGAAACATTGGAATGCT
TTGAAGCACGTTCTCGCTTACCTCAAAGGAACGTTGGACTACAGAATCACTTACCGACGTGGCACCACTATTCGA
CCATACGGATATGTTGACGCCGATTATGCCGGTGACCTGGACACTTCCCAATCTACTGAAGGCCACATCTTTTTT
GTTGCTGGAGGTCCCGTTTCGTGGACTAGCAAACGTCAGGACACAGTTACTTTGTCGACTGTAGAGGCAGAGTAT
ACTGCGTTTGCGCGCGCTACTCAACAGGCTATATGGATCAGCAAGTTCTTCGATGAAGTCGCTCTTGCTCAGGAT
ATGCCACTTAACATTTATGCGGACAACAATGGGGCGATCTCTAATACGCAGAACGACAAGAACCACAGGCGTACA
AAGCACATTTGGGTGAAATACCACTTCACCAAGGAGAAGGTCGCGAGTGGAGAAGTAACGTTTACTTATGTTCCC
TCTGCTCAGAATCTCGCCGATATCCTTACCAAGCCCCTCGCCCGTGAGGCCATTCTCCGCTGCTGCAAGGGCATA
GGTCTTTTCTAG
Transcript >AgabiH97|027490
ATGTTCGCCGACACAGCGAAATTCAACGGCATGAATTGGGTAACATGGAAGGGACTCATTAAGATAGCAGCCGAG
TTGCGGGGTGTATACAGATACCTTGATGGTTCCATTCAAAATCCTACAGGCGTTGTCATACCGAATCCATTAACT
GTCCCACTACCTCCTTCTACACCTGCGGAAGGCGCATCGCCTACCCAAACGGTCACACAACTTCCCCCACCGGCA
GATACCCCATGGGAATCACTATTTCCTTCTCCATCAGAATGGAGAGTCCGGAACGCATGGGCAATGGGGTTGTTG
ATATATAACACAAGCGATCCCGTTGGGCTGGGCATTAACATCAGTGGAACAGCAGCCGACGCGTGGAAGTCATAC
ACGGACACTTACGAAGTAGTATCCGAAATTGCCATTCTCAATGCCGAATTAACCTTGTGTAACTCGTCCTATGCT
GATGGCCAAGATTTTGTGGAATTCGTAACTCAGATGCGCACTAAATGGTCAAATGCAACTGCTCTCGGCGCTACG
ATTGACGACAAGTCCTTTAGGACCATAATACTCAATGCCCTCCCTCGATCATGGGACCCAATCGTCGCTACCCTC
TACACCACTCAGTCATCTCGGGAAGCGATCAACCAACTGATGACACACTGGGCACGGGTTAGCAGGGATCGAGTT
TCCAATCCACAGAGTTCTACCACAGCGCTTCAGGCAAGCAATACGAGGAGTAATCGTCAACGTACCCAATCCCAA
CTACAATGTACCAACTCCAACTGCAAACGACGTGGCCATCTTATTGAGGACTGCTACTGGCCTGGAGGCGGCAAA
GAAGGCCAATTTCCCCCCGGTTTCGGCAAACGAGGAGGAGCTAGAGGTACCGCTGCACAGAACAACTATAACCAA
CAAACTTCAGCCAACGTGACGGATACAAACCCACAGACTACTGAACCCACCGTGTTCGCCTTAGCAGTCGTTACC
GAGGTCAACGACGATACCCTGGTACAAGCCGATCCACCCGCTCCAAACATTCCCATGTCTTATGCAGCAATCGTC
TCACAACCCATCGTCACTTTACTCGATTCGGGAGCGAGCGATCACTGCTTCGTTCGACGTGAAAGCTTCTCCAAC
TATAGAAAGATAACTCCCGTTCGCGTAGGACATTCCGCAGGGAAAGGTGCTACGTTTGACATCGAGGGTGAAGGA
CATGCGGATTTTTTTACCAAAGCCAGTGATAACGTCTCGAAGATTGTTCTTGCGGGAGCGCTCCATACGCCACAG
CTCAGATCCAACCTAATCTCTGTATCTCGACTAGTTGCCAAAGGATCCACCGTCAAATTTGAAGCTAGCTCAGCG
GTCGTTCGTAATGCTGCTGGGAACCATGTGTTTACGGCGGTGAAGAAAGATGGCTTGTATATTGTCGAAACCGTC
TATCCATACAAAACATCTATCAACGCCGTTCAGGCAAAGAGGAAACCAGCGTCTTATGAAATCTGGCACAGGCGA
CTAGGACACGTACCTGTCAATCTCATTTCGCGTATGTCGAAGGAGGATTTGGTTGACGGCTTGAACACCAGTGGG
GAACCTAACATGAAGGCTTTGTGCAAAGATTGTATATATGGAAAGCATACCACGCACCCTTTCAATGATCCCATC
CCGCCGGAATCAGACATCCTTGAACGGGTGTATATTGATATTTGGGGTCCCGCACCGGTCGTCTCAGCTGGGGGA
GCTAAATACTTCATGTTAGTGATGGATGATGCGACATCCTATCGTCGAGTCTATTTCCTCCCTTCCAAAACAGCA
GACGCAACTCTACGAGCCTTCAGGGACTTTCACGATGAGTCTGAGCGTCAGACGGGGAAGAAACTTAAGCGTCAG
ACGGGGAAGAAACTTAAGCGTCAGACGGGGAAGAAACTTAAGCGTGTACGCTCGGATATGGGGAGAGAGTGGCAT
AACGATACCTGGAACACCTATGTGAAGGAGAAGGGAATCATTCTCGATTTCTCCACGCCATACGCTCACCAACAG
AACAGTAAAGCTGAGCGCAGCATGCGCACACTACTTGAGACGGCCCGTTCCATGTTGTCCGACTCGGGTTTGCCC
CAGAAGTATTGGGCGGATGCAGTGCAAACGGCCGTCTACACTCGAAACTTTATTCCCCCATCCAATAAGCCCTCC
ACTATTCCTGCTGAGCGTTGGTCGGGGAAACGTCAAGACGTCTCCCATCTTCGTCCATTCGGTTCGGTGTCGTAT
GCGCATATACCTCCCGAAGTCAGTCCCTCAAAGCTGTCACCACGTTCTGTTAAGCTCACCTTGGTCGGTTATTAC
GATCGATCGGGTTATAAGCTGCTGGACAGAGGAACTGGGAAGGTTTATAGGTCTAGAGACGTGATATTCGAAGAA
AGGGTTCCGCATTTCTCCACTGACCCAATCGTTACGTATCCGGTTTTCTCGGATGTTGTGGCGTCCGACCCGACC
GCAATAGCTCCACGTCCTAAGCCTATATCTAACCTCCATCCCACCTCCTCCACCAACGCTGAGTCCTCCGAGGCT
CCACAGGCTGGTATCCCGCAAGCCGACGACAAGGAAGGGGCTGATAATGAGGTGGATGACAGTGAGACTGAGGTA
GCTCGTATGCTGGTGGAAGGAACCAACACGGACGACCCACCCCGACATGATGCCGCTGACTCGATAGCGCAACGT
CGTACTAGGCGAGAGCCTCGCATGAGCCGGAGGATGCAGGAGAGCGTTGAATATTTGGAACGTTCGAGGGCGAAC
GTCGTAACGGTGCCACCTCCCACCTATGTCAACGATGACTTATACGTTCCGAAATCTTTTGCAGATGCTATGAGA
TGTCCTGAGCTCTGGTATGAGCCGATGCTAAAGGAACTCGCCGCTATGAAGGACAAGGGTGTCTATCGACTAGTC
CCTCGGCCGAAGGGGAAGAACGTGGTGAAGTCTCGTTGGGTCTTTGCGAACAAGTTCAATGACTCCGGGAACATC
TCTGGGCATAAAGCACGCTTAGTGGCGAAAGGGTTTACTCAGGTCCTGGGGGAGGACTACGACGAGACCTATGCT
TCGGTGGCCCGCCTGGAGTCCGTTCGACTCGTCTGCGCTATCGCCGCCTCATTTGGTATGCGACTTTGGCAGGTG
GACTTCGTGTCTGCTTTCCTTAACAGTGATAATGAGTTCGAGGTGTTTATGGAGCAACCGCCCAGTTTTGAGGAA
GGGGGAGATGACGTCTGGCTACTCCTCAAGACCTTGTACGGTACAATGCAAGGCGCACACGATTGGGCTCGAAAC
CTCGAAAACACTTATCAAGGCCACGGGTACTATACTTCAAAGGCAGATCCCCAGGTTCGCTCGAGAGTTATACAC
GACGAGTTCACACTCACCTCCACTTGGACCGACGACATACTAGGAGCGTCTACAACAGAAACCGGCGAACAGAAA
GCTAAGCAGGAGTTGGGGAATAGTTATGAGTTGAAGGATCTAGGTGCAGCGAAGTTTATTCTGGGGATGAAGATC
GAGCATGATGACGCAGGGAATATTCGTCTTTCTCAACGAGCTTATTGCGAGAGAGTTATTGATTGTTTTCATATG
GCAGATGCGAAGCCCCGTTCAACTCCATTACCAGCTGGACTTACGCTATCCACAGAAGACTCACCCAAGTCTAAG
GAGGAGCTCGATGAGATGAAGAATGCACCGTTTCGCGAGGCGCTAGGATTCCTTATGTGGCTGCAGGTGGCCACC
CGACCTGACTTGTCATACGCGGTGAATCTACTATCTAGGTTCGCTAACAACCCAGGCAGGAAACATTGGAATGCT
TTGAAGCACGTTCTCGCTTACCTCAAAGGAACGTTGGACTACAGAATCACTTACCGACGTGGCACCACTATTCGA
CCATACGGATATGTTGACGCCGATTATGCCGGTGACCTGGACACTTCCCAATCTACTGAAGGCCACATCTTTTTT
GTTGCTGGAGGTCCCGTTTCGTGGACTAGCAAACGTCAGGACACAGTTACTTTGTCGACTGTAGAGGCAGAGTAT
ACTGCGTTTGCGCGCGCTACTCAACAGGCTATATGGATCAGCAAGTTCTTCGATGAAGTCGCTCTTGCTCAGGAT
ATGCCACTTAACATTTATGCGGACAACAATGGGGCGATCTCTAATACGCAGAACGACAAGAACCACAGGCGTACA
AAGCACATTTGGGTGAAATACCACTTCACCAAGGAGAAGGTCGCGAGTGGAGAAGTAACGTTTACTTATGTTCCC
TCTGCTCAGAATCTCGCCGATATCCTTACCAAGCCCCTCGCCCGTGAGGCCATTCTCCGCTGCTGCAAGGGCATA
GGTCTTTTCTAG
Gene >AgabiH97|027490
ATGTTCGCCGACACAGCGAAATTCAACGGCATGAATTGGGTAACATGGAAGGGACTCATTAAGATAGCAGCCGAG
TTGCGGGGTGTATACAGATACCTTGATGGTTCCATTCAAAATCCTACAGGCGTTGTCATACCGAATCCATTAACT
GTCCCACTACCTCCTTCTACACCTGCGGAAGGCGCATCGCCTACCCAAACGGTCACACAACTTCCCCCACCGGCA
GATACCCCATGGGAATCACTATTTCCTTCTCCATCAGAATGGAGAGTCCGGAACGCATGGGCAATGGGGTTGTTG
ATATATAACACAAGCGATCCCGTTGGGCTGGGCATTAACATCAGTGGAACAGCAGCCGACGCGTGGAAGTCATAC
ACGGACACTTACGAAGTAGTATCCGAAATTGCCATTCTCAATGCCGAATTAACCTTGTGTAACTCGTCCTATGCT
GATGGCCAAGATTTTGTGGAATTCGTAACTCAGATGCGCACTAAATGGTCAAATGCAACTGCTCTCGGCGCTACG
ATTGACGACAAGTCCTTTAGGACCATAATACTCAATGCCCTCCCTCGATCATGGGACCCAATCGTCGCTACCCTC
TACACCACTCAGTCATCTCGGGAAGCGATCAACCAACTGATGACACACTGGGCACGGGTTAGCAGGGATCGAGTT
TCCAATCCACAGAGTTCTACCACAGCGCTTCAGGCAAGCAATACGAGGAGTAATCGTCAACGTACCCAATCCCAA
CTACAATGTACCAACTCCAACTGCAAACGACGTGGCCATCTTATTGAGGACTGCTACTGGCCTGGAGGCGGCAAA
GAAGGCCAATTTCCCCCCGGTTTCGGCAAACGAGGAGGAGCTAGAGGTACCGCTGCACAGAACAACTATAACCAA
CAAACTTCAGCCAACGTGACGGATACAAACCCACAGACTACTGAACCCACCGTGTTCGCCTTAGCAGTCGTTACC
GAGGTCAACGACGATACCCTGGTACAAGCCGATCCACCCGCTCCAAACATTCCCATGTCTTATGCAGCAATCGTC
TCACAACCCATCGTCACTTTACTCGATTCGGGAGCGAGCGATCACTGCTTCGTTCGACGTGAAAGCTTCTCCAAC
TATAGAAAGATAACTCCCGTTCGCGTAGGACATTCCGCAGGGAAAGGTGCTACGTTTGACATCGAGGGTGAAGGA
CATGCGGATTTTTTTACCAAAGCCAGTGATAACGTCTCGAAGATTGTTCTTGCGGGAGCGCTCCATACGCCACAG
CTCAGATCCAACCTAATCTCTGTATCTCGACTAGTTGCCAAAGGATCCACCGTCAAATTTGAAGCTAGCTCAGCG
GTCGTTCGTAATGCTGCTGGGAACCATGTGTTTACGGCGGTGAAGAAAGATGGCTTGTATATTGTCGAAACCGTC
TATCCATACAAAACATCTATCAACGCCGTTCAGGCAAAGAGGAAACCAGCGTCTTATGAAATCTGGCACAGGCGA
CTAGGACACGTACCTGTCAATCTCATTTCGCGTATGTCGAAGGAGGATTTGGTTGACGGCTTGAACACCAGTGGG
GAACCTAACATGAAGGCTTTGTGCAAAGATTGTATATATGGAAAGCATACCACGCACCCTTTCAATGATCCCATC
CCGCCGGAATCAGACATCCTTGAACGGGTGTATATTGATATTTGGGGTCCCGCACCGGTCGTCTCAGCTGGGGGA
GCTAAATACTTCATGTTAGTGATGGATGATGCGACATCCTATCGTCGAGTCTATTTCCTCCCTTCCAAAACAGCA
GACGCAACTCTACGAGCCTTCAGGGACTTTCACGATGAGTCTGAGCGTCAGACGGGGAAGAAACTTAAGCGTCAG
ACGGGGAAGAAACTTAAGCGTCAGACGGGGAAGAAACTTAAGCGTGTACGCTCGGATATGGGGAGAGAGTGGCAT
AACGATACCTGGAACACCTATGTGAAGGAGAAGGGAATCATTCTCGATTTCTCCACGCCATACGCTCACCAACAG
AACAGTAAAGCTGAGCGCAGCATGCGCACACTACTTGAGACGGCCCGTTCCATGTTGTCCGACTCGGGTTTGCCC
CAGAAGTATTGGGCGGATGCAGTGCAAACGGCCGTCTACACTCGAAACTTTATTCCCCCATCCAATAAGCCCTCC
ACTATTCCTGCTGAGCGTTGGTCGGGGAAACGTCAAGACGTCTCCCATCTTCGTCCATTCGGTTCGGTGTCGTAT
GCGCATATACCTCCCGAAGTCAGTCCCTCAAAGCTGTCACCACGTTCTGTTAAGCTCACCTTGGTCGGTTATTAC
GATCGATCGGGTTATAAGCTGCTGGACAGAGGAACTGGGAAGGTTTATAGGTCTAGAGACGTGATATTCGAAGAA
AGGGTTCCGCATTTCTCCACTGACCCAATCGTTACGTATCCGGTTTTCTCGGATGTTGTGGCGTCCGACCCGACC
GCAATAGCTCCACGTCCTAAGCCTATATCTAACCTCCATCCCACCTCCTCCACCAACGCTGAGTCCTCCGAGGCT
CCACAGGCTGGTATCCCGCAAGCCGACGACAAGGAAGGGGCTGATAATGAGGTGGATGACAGTGAGACTGAGGTA
GCTCGTATGCTGGTGGAAGGAACCAACACGGACGACCCACCCCGACATGATGCCGCTGACTCGATAGCGCAACGT
CGTACTAGGCGAGAGCCTCGCATGAGCCGGAGGATGCAGGAGAGCGTTGAATATTTGGAACGTTCGAGGGCGAAC
GTCGTAACGGTGCCACCTCCCACCTATGTCAACGATGACTTATACGTTCCGAAATCTTTTGCAGATGCTATGAGA
TGTCCTGAGCTCTGGTATGAGCCGATGCTAAAGGAACTCGCCGCTATGAAGGACAAGGGTGTCTATCGACTAGTC
CCTCGGCCGAAGGGGAAGAACGTGGTGAAGTCTCGTTGGGTCTTTGCGAACAAGTTCAATGACTCCGGGAACATC
TCTGGGCATAAAGCACGCTTAGTGGCGAAAGGGTTTACTCAGGTCCTGGGGGAGGACTACGACGAGACCTATGCT
TCGGTGGCCCGCCTGGAGTCCGTTCGACTCGTCTGCGCTATCGCCGCCTCATTTGGTATGCGACTTTGGCAGGTG
GACTTCGTGTCTGCTTTCCTTAACAGTGATAATGAGTTCGAGGTGTTTATGGAGCAACCGCCCAGTTTTGAGGAA
GGGGGAGATGACGTCTGGCTACTCCTCAAGACCTTGTACGGTACAATGCAAGGCGCACACGATTGGGCTCGAAAC
CTCGAAAACACTTATCAAGGCCACGGGTACTATACTTCAAAGGCAGATCCCCAGGTTCGCTCGAGAGTTATACAC
GACGAGTTCACACTCACCTCCACTTGGACCGACGACATACTAGGAGCGTCTACAACAGAAACCGGCGAACAGAAA
GCTAAGCAGGAGTTGGGGAATAGTTATGAGTTGAAGGATCTAGGTGCAGCGAAGTTTATTCTGGGGATGAAGATC
GAGCATGATGACGCAGGGAATATTCGTCTTTCTCAACGAGCTTATTGCGAGAGAGTTATTGATTGTTTTCATATG
GCAGATGCGAAGCCCCGTTCAACTCCATTACCAGCTGGACTTACGCTATCCACAGAAGACTCACCCAAGTCTAAG
GAGGAGCTCGATGAGATGAAGAATGCACCGTTTCGCGAGGCGCTAGGATTCCTTATGTGGCTGCAGGTGGCCACC
CGACCTGACTTGTCATACGCGGTGAATCTACTATCTAGGTTCGCTAACAACCCAGGCAGGAAACATTGGAATGCT
TTGAAGCACGTTCTCGCTTACCTCAAAGGAACGTTGGACTACAGAATCACTTACCGACGTGGCACCACTATTCGA
CCATACGGATATGTTGACGCCGATTATGCCGGTGACCTGGACACTTCCCAATCTACTGAAGGCCACATCTTTTTT
GTTGCTGGAGGTCCCGTTTCGTGGACTAGCAAACGTCAGGACACAGTTACTTTGTCGACTGTAGAGGCAGAGTAT
ACTGCGTTTGCGCGCGCTACTCAACAGGCTATATGGATCAGCAAGTTCTTCGATGAAGTCGCTCTTGCTCAGGAT
ATGCCACTTAACATTTATGCGGACAACAATGGGGCGATCTCTAATACGCAGAACGACAAGAACCACAGGCGTACA
AAGCACATTTGGGTGAAATACCACTTCACCAAGGAGAAGGTCGCGAGTGGAGAAGTAACGTTTACTTATGTTCCC
TCTGCTCAGAATCTCGCCGATATCCTTACCAAGCCCCTCGCCCGTGAGGCCATTCTCCGCTGCTGCAAGGGCATA
GGTCTTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail