Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027420
Gene name
Locationscaffold_11:1521832..1523527
Strand-
Gene length (bp)1695
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.9E-13 50 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 42 376 5.0E-32
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 33 369 7.0E-24
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 8 369 3.0E-20
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 41 317 5.0E-18
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 11 325 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 42 376 5.0E-32
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 33 369 7.0E-24
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 8 369 3.0E-20
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 41 317 5.0E-18
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 11 325 3.0E-15
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 39 382 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027420
MVLRPGFFLLFNLLGVLAWPTQFPERTTPSELLDPYPHKPRITFKDDGTLKITVFSDLHFGENPWDVWGPQQDSN
STRVMKRVLKDENPDYAVLNGDLITGENTFRENATRLIDEIVAPLNAARVPFSSAHGNHDNQVNITHAEEIAREQ
QVAPLSYTRFSAPGVGGEGGAGNYWVPIYKKKSDNAPYLIIWFFDSRGGVTPQNKPAADWVDASVADWIESETKL
MDEVWGPGEQRSALAFVHIPPHVMQPVQKTITPEKNPGLNADVLGTGSAQSTSSTSPPAQDTPFWDSANKNIKNI
VAFISGHDHGNEWCAREPTKDVVFCFDKHSGYGGYGDSSWGYGVRNIVFHAPGNGKGKPKVESWIRLEEGQTRAH
VWLDNTLGH*
Coding >AgabiH97|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCTACTCAGTTCCCCGAA
AGAACAACTCCGAGCGAACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTA
AAAATCACTGTCTTTTCTGACCTCCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCGCAACAGGATTCGAAT
AGCACTAGGGTCATGAAACGAGTCTTGAAGGATGAAAATCCTGACTATGCTGTATTGAATGGAGATCTCATTACG
GGAGAAAACACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGCCGCCCGAGTT
CCTTTCTCTTCAGCCCACGGGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAA
CAAGTTGCACCTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGG
GTTCCTATCTACAAGAAAAAATCAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGATTCTCGCGGTGGCGTA
ACACCCCAGAATAAACCCGCTGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACAAAACTC
ATGGACGAAGTTTGGGGTCCGGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCTCACGTAATGCAA
CCAGTTCAGAAGACAATAACCCCCGAGAAGAATCCAGGACTAAATGCGGACGTACTCGGCACCGGATCTGCCCAA
TCTACCTCGAGCACGTCTCCGCCTGCGCAAGATACCCCTTTCTGGGACTCGGCGAATAAGAACATCAAAAATATT
GTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGGTGTGCACGTGAACCGACTAAAGACGTCGTCTTCTGT
TTCGATAAACACTCCGGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGTAACATCGTCTTCCAC
GCTCCTGGTAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTAGAGGAAGGTCAAACGAGGGCACAT
GTTTGGCTTGATAATACTTTGGGACATTAA
Transcript >AgabiH97|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCTACTCAGTTCCCCGAA
AGAACAACTCCGAGCGAACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTA
AAAATCACTGTCTTTTCTGACCTCCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCGCAACAGGATTCGAAT
AGCACTAGGGTCATGAAACGAGTCTTGAAGGATGAAAATCCTGACTATGCTGTATTGAATGGAGATCTCATTACG
GGAGAAAACACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGCCGCCCGAGTT
CCTTTCTCTTCAGCCCACGGGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAA
CAAGTTGCACCTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGG
GTTCCTATCTACAAGAAAAAATCAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGATTCTCGCGGTGGCGTA
ACACCCCAGAATAAACCCGCTGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACAAAACTC
ATGGACGAAGTTTGGGGTCCGGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCTCACGTAATGCAA
CCAGTTCAGAAGACAATAACCCCCGAGAAGAATCCAGGACTAAATGCGGACGTACTCGGCACCGGATCTGCCCAA
TCTACCTCGAGCACGTCTCCGCCTGCGCAAGATACCCCTTTCTGGGACTCGGCGAATAAGAACATCAAAAATATT
GTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGGTGTGCACGTGAACCGACTAAAGACGTCGTCTTCTGT
TTCGATAAACACTCCGGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGTAACATCGTCTTCCAC
GCTCCTGGTAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTAGAGGAAGGTCAAACGAGGGCACAT
GTTTGGCTTGATAATACTTTGGGACATTAA
Gene >AgabiH97|027420
ATGGTCCTCCGCCCCGGTTTCTTCCTCTTGTTCAACTTACTAGGCGTTCTAGCATGGCCTACTCAGTTCCGTATG
TTGAACTCTACTCATTCCTTCTGTCAAACATACCAATATCCCGTGACAACTAGCCGAAAGAACAACTCCGAGCGA
ACTCTTGGACCCTTATCCCCATAAACCTCGTATTACCTTCAAAGATGATGGTACTCTAAAAATCACTGTCTTTTC
TGACCTCCACTTCGGGGAAAACCCATGGGATGTATGGGGTCCGCAACAGGATTCGAATAGCACTAGGGTCATGAA
ACGAGTCTTGAAGGATGAAAATCCTGACTATGCGTACGTATACTTCGATCGCCTGTATACCCATCACGGCCTGAA
TGATGTTTCAGTGTATTGAATGGAGATCTCATTACGGGAGAAAGTGAGCATATTCCCGAGACTATTGAAAGAAAG
ATACTCAGATAAATTAGACACATTCAGGGAAAATGCAACAAGGTTAATCGATGAAATTGTTGCTCCCTTGAATGC
CGCCCGAGTTCCTTTCTCTTCAGCCCACGGGGTGCGCAGTTCCAAATATCGCGCACATCGTACCGCTGACTTGGT
GTACTTGTTAGAATCACGACAATCAAGTCAACATCACTCATGCCGAAGAAATTGCCCGTGAACAACAAGTTGCAC
CTCTCAGTTACACGCGATTCTCTGCGCCTGGCGTTGGTGGCGAAGGCGGAGCCGGAAACTACTGGGTTCCTGTAA
GTCAACTTGACAATCAAGAATTGACAAGTTGCTTATATCGTGTAGATCTACAAGAAAAAATCAGGTGTGTTCTTC
TAATACATTCTGTTTTGTCCTTCGAGATGAATTTTTGTTAGATAACGCTCCTTATCTTATTATTTGGTTCTTTGA
TTCTCGCGGTTCGTAACGTTCTCAGCCTCACCTAGTGACTCCCTTCATGAGTTTTTCGATAGGTGGCGTAACACC
CCAGAATAAACCCGCTGCAGACTGGGTCGACGCGTCTGTTGCTGATTGGATCGAATCCGAAACAAAACTCATGGA
CGAAGTTTGGGGTCCGGGAGAGCAGCGTTCTGCGCTGGCATTTGTCCATATCCCTCCGTCTGTCCAAAGTTCTCC
TTTCTATCCTTACAAGTTCATGATTCTATATGATACAGTCACGTAATGCAACCAGTTCAGAAGACAATAACCCCC
GAGAAGAATCCAGGACTAAATGGTATCTCTTTCAAATCAAGCATAACCGGAAAGCAACAGACTAAAGAGATTATT
TTTCCAGCGGACGTACTCGGCACCGGATCTGCCCAATCTACCTCGAGCACGTCTCCGCCTGCGCAAGATACCCCT
TTCTGGGACTCGGCGAATAAGAACATCAAAAATATTGTTGCTTTTATTTCGGGTCATGACCACGGTAACGAATGG
TGTGCACGTGAACCGACTAAAGACGTCGTCTTCTGTTTCGATAAACACTCCGGGTAGGTGTTGATTGCTGTTGAA
TTTTATTTTTACTTGATGGCGTATTAATGCAGGTATGGTGGCTATGGCGATTCTTCATGGGGTTATGGAGTTCGT
AACATCGTCTTCCACGCTCCTGGTAATGGTAAAGGTAAACCAAAGGTCGAGAGTTGGATTAGACTAGAGGAAGGT
CAAACGAGGGCACATGTTTGGCTTGATAATACTTTGGGACATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail