Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027360
Gene name
Locationscaffold_11:1503274..1504703
Strand-
Gene length (bp)1429
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 5.2E-17 46 174
PF13847 Methyltransf_31 Methyltransferase domain 1.3E-12 51 161
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-11 56 145
PF08242 Methyltransf_12 Methyltransferase domain 1.1E-10 57 147
PF08241 Methyltransf_11 Methyltransferase domain 7.8E-11 57 148
PF05175 MTS Methyltransferase small domain 5.3E-05 46 102
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 4.2E-05 51 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 44 163 2.0E-12
sp|Q7N2M5|UBIG_PHOLL Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 53 163 2.0E-11
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 53 163 4.0E-10
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 52 163 7.0E-10
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 44 163 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 44 163 2.0E-12
sp|Q7N2M5|UBIG_PHOLL Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 53 163 2.0E-11
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 53 163 4.0E-10
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 52 163 7.0E-10
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 44 163 1.0E-09
sp|A9L2Y4|UBIG_SHEB9 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 46 163 2.0E-09
sp|A6WNN7|UBIG_SHEB8 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 46 163 2.0E-09
sp|A3D499|UBIG_SHEB5 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 46 163 2.0E-09
sp|B8EA88|UBIG_SHEB2 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 46 163 2.0E-09
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 44 163 2.0E-09
sp|B0U3W1|UBIG_XYLFM Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 53 152 2.0E-09
sp|A1TSA0|UBIG_ACIAC Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 52 163 3.0E-09
sp|Q6D7X5|UBIG_PECAS Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiG PE=3 SV=1 44 163 4.0E-09
sp|Q87BG5|UBIG_XYLFT Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 53 149 6.0E-09
sp|B2I705|UBIG_XYLF2 Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 53 149 6.0E-09
sp|Q9PAM5|UBIG_XYLFA Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 53 149 7.0E-09
sp|C6DBN5|UBIG_PECCP Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiG PE=3 SV=1 44 163 7.0E-09
sp|B7NN47|UBIG_ECO7I Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiG PE=3 SV=1 53 163 7.0E-09
sp|Q21UL3|UBIG_RHOFT Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 22 149 8.0E-09
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 46 230 8.0E-09
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 53 149 8.0E-09
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 53 149 8.0E-09
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 53 149 8.0E-09
sp|Q2Y6Z3|UBIG_NITMU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiG PE=3 SV=1 44 163 9.0E-09
sp|Q7WGT9|UBIG_BORBR Ubiquinone biosynthesis O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiG PE=3 SV=2 53 163 1.0E-08
sp|Q7VKW2|UBIG_HAEDU Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiG PE=3 SV=1 53 152 1.0E-08
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 46 163 1.0E-08
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 46 163 1.0E-08
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 46 163 1.0E-08
sp|Q31GD8|UBIG_THICR Ubiquinone biosynthesis O-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiG PE=3 SV=1 40 163 1.0E-08
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 46 163 1.0E-08
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 46 163 1.0E-08
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|P37431|UBIG_SALTY Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiG PE=3 SV=2 53 163 1.0E-08
sp|B4TPG0|UBIG_SALSV Ubiquinone biosynthesis O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B4SYU8|UBIG_SALNS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella newport (strain SL254) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B4TBE3|UBIG_SALHS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B5FNR7|UBIG_SALDC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B5EYW1|UBIG_SALA4 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella agona (strain SL483) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|C0Q093|UBIG_SALPC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B5RCA1|UBIG_SALG2 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|B5R249|UBIG_SALEP Ubiquinone biosynthesis O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|Q57M77|UBIG_SALCH Ubiquinone biosynthesis O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=ubiG PE=3 SV=2 53 163 1.0E-08
sp|Q8Z560|UBIG_SALTI Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhi GN=ubiG PE=3 SV=1 53 163 1.0E-08
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 32 149 1.0E-08
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 32 149 2.0E-08
sp|B7UFP4|UBIG_ECO27 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B1LLI3|UBIG_ECOSM Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q31Z65|UBIG_SHIBS Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B2TW20|UBIG_SHIB3 Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B6I7I7|UBIG_ECOSE Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SE11) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B7M5R7|UBIG_ECO8A Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B7LAP9|UBIG_ECO55 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|A0KWN3|UBIG_SHESA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=ubiG PE=3 SV=1 46 163 2.0E-08
sp|B1IXV6|UBIG_ECOLC Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q3YZX6|UBIG_SHISS Ubiquinone biosynthesis O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q820C5|UBIG_SHIFL Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q0T2P9|UBIG_SHIF8 Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q1R9I4|UBIG_ECOUT Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B7MFZ8|UBIG_ECO45 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 53 163 2.0E-08
sp|B7MXR3|UBIG_ECO81 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B5YX17|UBIG_ECO5E Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q8XE29|UBIG_ECO57 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q32DV8|UBIG_SHIDS Ubiquinone biosynthesis O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B7N5J4|UBIG_ECOLU Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|P17993|UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) GN=ubiG PE=1 SV=1 53 163 2.0E-08
sp|Q8FFP0|UBIG_ECOL6 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q0TFL0|UBIG_ECOL5 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|B1X8C6|UBIG_ECODH Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|C4ZU73|UBIG_ECOBW Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|A7ZP50|UBIG_ECO24 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|A8A296|UBIG_ECOHS Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=ubiG PE=3 SV=1 53 163 2.0E-08
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 53 163 2.0E-08
sp|Q7VZG7|UBIG_BORPE Ubiquinone biosynthesis O-methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|B5XNZ3|UBIG_KLEP3 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|A9MJY3|UBIG_SALAR Ubiquinone biosynthesis O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 53 163 3.0E-08
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 53 149 4.0E-08
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 53 149 4.0E-08
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 53 149 4.0E-08
sp|B7LM95|UBIG_ESCF3 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiG PE=3 SV=1 53 163 4.0E-08
sp|Q0HIX5|UBIG_SHESM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=ubiG PE=3 SV=1 46 163 4.0E-08
sp|Q5P7U3|UBIG_AROAE Ubiquinone biosynthesis O-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ubiG PE=3 SV=1 53 163 4.0E-08
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 53 163 4.0E-08
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 53 163 4.0E-08
sp|A1RJD1|UBIG_SHESW Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiG PE=3 SV=1 46 149 5.0E-08
sp|A4Y759|UBIG_SHEPC Ubiquinone biosynthesis O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiG PE=3 SV=1 46 149 6.0E-08
sp|Q8EEG9|UBIG_SHEON Ubiquinone biosynthesis O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=ubiG PE=3 SV=1 46 149 6.0E-08
sp|A6TBT7|UBIG_KLEP7 Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiG PE=3 SV=1 53 163 6.0E-08
sp|Q3SK91|UBIG_THIDA Ubiquinone biosynthesis O-methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiG PE=3 SV=1 53 163 6.0E-08
sp|A8ADY5|UBIG_CITK8 Ubiquinone biosynthesis O-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiG PE=3 SV=1 53 163 7.0E-08
sp|Q2SE61|UBIG_HAHCH Ubiquinone biosynthesis O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiG PE=3 SV=1 53 163 7.0E-08
sp|Q885T9|UBIG_PSESM Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 53 163 8.0E-08
sp|B1J5G4|UBIG_PSEPW Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain W619) GN=ubiG PE=3 SV=1 53 163 8.0E-08
sp|A7MPA9|UBIG_CROS8 Ubiquinone biosynthesis O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiG PE=3 SV=1 53 163 9.0E-08
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 53 163 1.0E-07
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 53 163 1.0E-07
sp|B0KTX4|UBIG_PSEPG Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 53 163 1.0E-07
sp|B1Y2L3|UBIG_LEPCP Ubiquinone biosynthesis O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiG PE=3 SV=1 48 163 1.0E-07
sp|Q7W5Z6|UBIG_BORPA Ubiquinone biosynthesis O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiG PE=3 SV=2 53 163 1.0E-07
sp|A4WCN5|UBIG_ENT38 Ubiquinone biosynthesis O-methyltransferase OS=Enterobacter sp. (strain 638) GN=ubiG PE=3 SV=1 53 163 1.0E-07
sp|B5FDT8|UBIG_VIBFM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=ubiG PE=3 SV=1 53 163 1.0E-07
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|A1K8Q1|UBIG_AZOSB Ubiquinone biosynthesis O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 44 163 2.0E-07
sp|C3LLV3|UBIG_VIBCM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|Q9KSJ9|UBIG_VIBCH Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|A5F1U0|UBIG_VIBC3 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|A8H499|UBIG_SHEPA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiG PE=3 SV=1 46 149 2.0E-07
sp|B0V5X4|UBIG_ACIBY Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|B7IBN2|UBIG_ACIB5 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|B7H2Y9|UBIG_ACIB3 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|B0VMN8|UBIG_ACIBS Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|Q5E5J8|UBIG_VIBF1 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|B2I023|UBIG_ACIBC Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|C1DRQ3|UBIG_AZOVD Ubiquinone biosynthesis O-methyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiG PE=3 SV=1 53 163 2.0E-07
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 53 149 3.0E-07
sp|B1JS96|UBIG_YERPY Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|Q66CZ4|UBIG_YERPS Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|A4TNI8|UBIG_YERPP Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|Q1CFZ1|UBIG_YERPN Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|A9R284|UBIG_YERPG Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|Q8ZGR6|UBIG_YERPE Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|B2K9A4|UBIG_YERPB Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|Q1C9H5|UBIG_YERPA Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|A7FKF4|UBIG_YERP3 Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiG PE=3 SV=1 56 163 3.0E-07
sp|Q2NSL7|UBIG_SODGM Ubiquinone biosynthesis O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=ubiG PE=3 SV=1 53 163 3.0E-07
sp|Q4ZQ90|UBIG_PSEU2 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiG PE=3 SV=1 53 163 3.0E-07
sp|Q48FM4|UBIG_PSE14 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiG PE=3 SV=1 53 163 3.0E-07
sp|A4VLX7|UBIG_PSEU5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=ubiG PE=3 SV=1 53 163 3.0E-07
sp|B2JEZ6|UBIG_BURP8 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiG PE=3 SV=1 22 163 3.0E-07
sp|Q9JWE6|UBIG_NEIMA Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 8 163 3.0E-07
sp|Q3ILA5|UBIG_PSEHT Ubiquinone biosynthesis O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiG PE=3 SV=1 57 149 4.0E-07
sp|Q81ZZ2|UBIG_NITEU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiG PE=3 SV=1 47 163 4.0E-07
sp|Q0HV07|UBIG_SHESR Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-7) GN=ubiG PE=3 SV=1 46 163 5.0E-07
sp|B0TT38|UBIG_SHEHH Ubiquinone biosynthesis O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiG PE=3 SV=1 46 149 5.0E-07
sp|A1U3K1|UBIG_MARHV Ubiquinone biosynthesis O-methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiG PE=3 SV=1 53 163 5.0E-07
sp|A9M0C4|UBIG_NEIM0 Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 8 163 6.0E-07
sp|Q8Y0Z5|UBIG_RALSO Ubiquinone biosynthesis O-methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ubiG PE=3 SV=2 53 163 6.0E-07
sp|B7VGS0|UBIG_VIBTL Ubiquinone biosynthesis O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=ubiG PE=3 SV=1 53 163 7.0E-07
sp|A8GGX8|UBIG_SERP5 Ubiquinone biosynthesis O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=ubiG PE=3 SV=1 50 163 9.0E-07
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 56 149 1.0E-06
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 56 165 1.0E-06
sp|Q87ND5|UBIG_VIBPA Ubiquinone biosynthesis O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiG PE=3 SV=1 53 163 1.0E-06
sp|B5BCS0|UBIG_SALPK Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiG PE=3 SV=1 53 163 1.0E-06
sp|Q5PCY1|UBIG_SALPA Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiG PE=3 SV=1 53 163 1.0E-06
sp|B3H0C8|UBIG_ACTP7 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 53 149 1.0E-06
sp|Q9JXI7|UBIG_NEIMB Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 8 163 1.0E-06
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 43 152 2.0E-06
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 53 163 2.0E-06
sp|P08442|Y1184_SYNP6 Uncharacterized protein syc1184_c OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc1184_c PE=4 SV=1 56 149 2.0E-06
sp|Q9CMI6|UBIG_PASMU Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 44 149 3.0E-06
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 43 152 3.0E-06
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 43 152 3.0E-06
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 43 152 3.0E-06
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 43 152 3.0E-06
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 43 152 3.0E-06
sp|Q21IR9|UBIG_SACD2 Ubiquinone biosynthesis O-methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiG PE=3 SV=1 56 163 4.0E-06
sp|Q46Y42|UBIG_CUPPJ Ubiquinone biosynthesis O-methyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiG PE=3 SV=1 53 163 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027360
MEDSSGLYNLPKGGEPEFGRLDIQHRLWLLSLGGLVPPEIETEVSRHMEQTKGGAILDVGCGSAIWSVQMAEKFP
SARVVAVDITEPSQRSFPSNFSFKSHNLANGLPSEFEAGFNIIHCRTVLQHVPDPQILVDSMAKCLKPGGFLFLV
DVEVDSTFDENRKRLEPFIYDPALSVETNLENSRGLSWTSGWLHMLGLSTRSSKYKAPPSMIQQSESLNELMAKV
CWFPIGWEDKALENGKELGELSAEVVEGLFKLSRDSFKKVEGVPSEIKDALIERGRQEFRERNAYLSGWYVVARK
VKTRSSSLSKWVERIRYLFGSRKSVE*
Coding >AgabiH97|027360
ATGGAGGACTCATCTGGCTTATATAACCTCCCCAAAGGAGGTGAACCTGAATTTGGACGACTCGATATTCAACAC
AGATTATGGCTTCTATCATTAGGAGGTTTGGTTCCACCCGAAATCGAGACTGAAGTCAGTCGACACATGGAACAG
ACCAAGGGTGGGGCGATTTTGGATGTCGGATGTGGCTCGGCTATCTGGTCTGTCCAGATGGCTGAGAAATTCCCT
TCGGCACGAGTTGTCGCCGTGGACATTACAGAGCCAAGTCAAAGGTCGTTCCCTTCTAATTTCAGTTTCAAGAGT
CACAACCTTGCCAATGGACTTCCGTCCGAGTTTGAAGCCGGTTTCAACATCATACACTGTCGAACAGTTCTTCAA
CATGTCCCTGATCCTCAGATATTAGTAGACTCCATGGCAAAGTGTCTCAAGCCTGGCGGGTTTCTGTTTCTTGTG
GATGTCGAGGTGGATTCAACCTTTGACGAGAACAGGAAACGCCTCGAACCATTTATCTACGACCCTGCATTGAGC
GTCGAAACGAATCTAGAGAACTCAAGAGGGCTATCATGGACCTCGGGTTGGCTGCATATGCTGGGTCTATCCACC
CGGAGTTCCAAATACAAAGCCCCTCCAAGCATGATTCAACAATCCGAGTCGTTAAATGAGTTGATGGCGAAGGTT
TGCTGGTTTCCAATTGGCTGGGAGGACAAAGCCTTAGAAAACGGCAAGGAGCTTGGGGAATTAAGTGCTGAAGTT
GTCGAGGGACTTTTTAAACTGAGTCGAGATTCCTTCAAGAAAGTAGAAGGTGTTCCGTCGGAAATTAAGGATGCA
CTTATAGAGCGTGGGCGACAAGAATTCCGTGAACGCAATGCATACCTTTCCGGTTGGTATGTCGTGGCTCGAAAG
GTGAAAACGAGGTCATCATCATTATCGAAATGGGTGGAAAGAATCAGATATCTTTTTGGGTCGCGGAAGAGCGTC
GAGTAA
Transcript >AgabiH97|027360
ATGGAGGACTCATCTGGCTTATATAACCTCCCCAAAGGAGGTGAACCTGAATTTGGACGACTCGATATTCAACAC
AGATTATGGCTTCTATCATTAGGAGGTTTGGTTCCACCCGAAATCGAGACTGAAGTCAGTCGACACATGGAACAG
ACCAAGGGTGGGGCGATTTTGGATGTCGGATGTGGCTCGGCTATCTGGTCTGTCCAGATGGCTGAGAAATTCCCT
TCGGCACGAGTTGTCGCCGTGGACATTACAGAGCCAAGTCAAAGGTCGTTCCCTTCTAATTTCAGTTTCAAGAGT
CACAACCTTGCCAATGGACTTCCGTCCGAGTTTGAAGCCGGTTTCAACATCATACACTGTCGAACAGTTCTTCAA
CATGTCCCTGATCCTCAGATATTAGTAGACTCCATGGCAAAGTGTCTCAAGCCTGGCGGGTTTCTGTTTCTTGTG
GATGTCGAGGTGGATTCAACCTTTGACGAGAACAGGAAACGCCTCGAACCATTTATCTACGACCCTGCATTGAGC
GTCGAAACGAATCTAGAGAACTCAAGAGGGCTATCATGGACCTCGGGTTGGCTGCATATGCTGGGTCTATCCACC
CGGAGTTCCAAATACAAAGCCCCTCCAAGCATGATTCAACAATCCGAGTCGTTAAATGAGTTGATGGCGAAGGTT
TGCTGGTTTCCAATTGGCTGGGAGGACAAAGCCTTAGAAAACGGCAAGGAGCTTGGGGAATTAAGTGCTGAAGTT
GTCGAGGGACTTTTTAAACTGAGTCGAGATTCCTTCAAGAAAGTAGAAGGTGTTCCGTCGGAAATTAAGGATGCA
CTTATAGAGCGTGGGCGACAAGAATTCCGTGAACGCAATGCATACCTTTCCGGTTGGTATGTCGTGGCTCGAAAG
GTGAAAACGAGGTCATCATCATTATCGAAATGGGTGGAAAGAATCAGATATCTTTTTGGGTCGCGGAAGAGCGTC
GAGTAA
Gene >AgabiH97|027360
ATGGAGGACTCATCTGTGCGTCTTCCATCCTACTTTTCTAAGAATCATATTTCATTCATATGTTATCCGTAGGGC
TTATATAACCTCCCCAAAGGAGGTGAACCTGAATTTGGAGTTAGTGATTTTTTTGTTGCGAAATTTTTGAATAAC
AGGCGAATCATGCATAGCGACTCGATATTCAACACAGATTATGGCTTCTATCATTAGGAGGTTTGGTTCCACCCG
AAATCGAGACTGAAGTCAGTCGACACATGGAACAGACCAAGGGTGGGGCGATTTTGGATGTCGGATGTGGCTCGG
CTATCTGGTCAGTCAATTCAACGGATGAATAGATCATCCCTCACATTTAGGACTCGGTAGGTCTGTCCAGATGGC
TGAGAAATTCCCTTCGGCACGAGTTGTCGCCGTGGACATTACAGAGCCAAGTCAAAGGTATTCGGAATTCTATAA
TTATAATCTCCTTTACAGCTAACGTGTCAACAATTTAGGTCGTTCCCTTCTAATTTCAGGTCCGTGTTTTTGACG
CTTGTTGCTAGACGTTATTGATATGGAAAGATGTGCATAGTTTCAAGAGTCACAACCTTGCCAATGGACTTCCGT
CCGAGTTTGAAGCCGGTTTCAACATCATACACTGTCGAACAGTTCTTCAACATGTAGGTTAATTCCTCGTATTGT
CCCAGGATCTTCATTCCATCGTCTGCAGGTCCCTGATCCTCAGATATTAGTAGACTCCATGGCAAAGTGTCTCAA
GCCTGGTAAGCCGTTGCCTTGGAAAAAATGCGGTACAAGGTTATGAATTCATGAATATAGGCGGGTTTCTGTTTC
TTGTGGATGTCGAGGTGGATTCAACCTTTGACGAGAACAGGAAACGCCTCGAACCATTTATCTACGACCCTGCAT
TGAGCGTCGAAACGAATCTAGAGAACTCAAGAGGGCTATCATGGACCTCGGGTTGGCTGCATATGCTGGGTCTAT
CCACCCGGAGTTCCAAATACAAAGCCCCTCCAAGCATGATTCAACAATCCGAGTCGTTAAATGAGTTGATGGCGA
AGGTTTGCTGGTTTCCAATTGGCTGGGAGGACAAAGCCTTAGAAAACGGCAAGGAGCTTGGGGAATTAAGTGCTG
AAGTTGTCGAGGTAAGGTGGTCGCGAAGCTGGAACGCCATTGCAAGCACAATGTTAACTGACCATGGTAATCTGT
ATAGGGACTTTTTAAACTGAGTCGAGATTCCTTCAAGAAAGTAGAAGGTGTTCCGTCGGAAATTAAGGATGCACT
TATAGAGCGTGGGCGACAAGAATTCCGTGAACGCAATGCATACCTTTCCGGTTGGTATGTCGTGGCTCGAAAGGT
GAAAACGAGGTCATCATCATTATCGAAATGGGTGGAAAGAATCAGATATCTTTTTGGGTCGCGGAAGAGCGTCGA
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail