Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027250
Gene name
Locationscaffold_11:1474979..1476400
Strand+
Gene length (bp)1421
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5632 0.3553 0.0588 0.3695 0.2498 0.0263 0.2343 0.2916 0.2206 0.1051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 3.73 1.51 5.95
Initials Initials knots 6.38 2.94 9.82
Pileal_Stipeal_center Stage I stipe center 3.32 1.38 5.27
Pileal_Stipeal_shell Stage I stipe shell 3.24 1.34 5.14
DIF_stipe_center Stage II stipe center 3.13 1.26 5.00
DIF_stipe_shell Stage II stipe shell 3.99 1.66 6.32
DIF_stipe_skin Stage II stipe skin 4.37 1.78 6.95
DIF_cap_skin Stage II cap skin 2.91 1.17 4.66
DIF_cap_tissue Stage II cap tissue 2.51 0.98 4.05
DIF_gill_tissue Stage II gill tissue 3.11 1.25 4.97
YFB_stipe_center Young fruiting body stipe center 4.10 1.77 6.42
YFB_stipe_shell Young fruiting body stipe shell 4.71 2.05 7.37
YFB_stipe_skin Young fruiting body stipe skin 3.26 1.32 5.20
YFB_cap_skin Young fruiting body cap skin 2.90 1.17 4.64
YFB_cap_tissue Young fruiting body cap tissue 3.99 1.72 6.26
YFB_gill_tissue Young fruiting body gill tissue 3.22 1.31 5.14
YFB_veil Young fruiting body veil 3.02 1.22 4.82

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.782113 no
Casing YFB_stipe_center 0.898073 no
Casing YFB_stipe_shell 0.687043 no
Casing YFB_stipe_skin 0.848269 no
Casing YFB_cap_skin 0.673106 no
Casing YFB_cap_tissue 0.930279 no
Casing YFB_gill_tissue 0.835337 no
Casing YFB_veil 0.740388 no
Casing Initials 0.202801 no
Casing Pileal_Stipeal_center 0.871498 no
Casing Pileal_Stipeal_shell 0.835744 no
Casing DIF_stipe_center 0.791961 no
Casing DIF_stipe_shell 0.928403 no
Casing DIF_stipe_skin 0.815553 no
Casing DIF_cap_skin 0.678558 no
Casing DIF_cap_tissue 0.432631 no
DIF_gill_tissue YFB_stipe_center 0.615990 no
DIF_gill_tissue YFB_stipe_shell 0.379989 no
DIF_gill_tissue YFB_stipe_skin 0.953843 no
DIF_gill_tissue YFB_cap_skin 0.931940 no
DIF_gill_tissue YFB_cap_tissue 0.669592 no
DIF_gill_tissue YFB_gill_tissue 0.964968 no
DIF_gill_tissue YFB_veil 0.973940 no
YFB_stipe_center YFB_stipe_shell 0.833383 no
YFB_stipe_center YFB_stipe_skin 0.698899 no
YFB_stipe_center YFB_cap_skin 0.502753 no
YFB_stipe_center YFB_cap_tissue 0.973440 no
YFB_stipe_center YFB_gill_tissue 0.684966 no
YFB_stipe_center YFB_veil 0.574135 no
YFB_stipe_shell YFB_stipe_skin 0.461539 no
YFB_stipe_shell YFB_cap_skin 0.285338 no
YFB_stipe_shell YFB_cap_tissue 0.792928 no
YFB_stipe_shell YFB_gill_tissue 0.443173 no
YFB_stipe_shell YFB_veil 0.342648 no
YFB_stipe_skin YFB_cap_skin 0.873217 no
YFB_stipe_skin YFB_cap_tissue 0.747978 no
YFB_stipe_skin YFB_gill_tissue 0.988662 no
YFB_stipe_skin YFB_veil 0.925081 no
YFB_cap_skin YFB_cap_tissue 0.551685 no
YFB_cap_skin YFB_gill_tissue 0.888030 no
YFB_cap_skin YFB_veil 0.960086 no
YFB_cap_tissue YFB_gill_tissue 0.728168 no
YFB_cap_tissue YFB_veil 0.620649 no
YFB_gill_tissue YFB_veil 0.937256 no
Initials DIF_gill_tissue 0.063570 no
Initials YFB_stipe_center 0.311750 no
Initials YFB_stipe_shell 0.542332 no
Initials YFB_stipe_skin 0.085726 no
Initials YFB_cap_skin 0.040501 yes
Initials YFB_cap_tissue 0.282209 no
Initials YFB_gill_tissue 0.084700 no
Initials YFB_veil 0.053358 no
Initials Pileal_Stipeal_center 0.089301 no
Initials Pileal_Stipeal_shell 0.073585 no
Initials DIF_stipe_center 0.071968 no
Initials DIF_stipe_shell 0.271262 no
Initials DIF_stipe_skin 0.421233 no
Initials DIF_cap_skin 0.038942 yes
Initials DIF_cap_tissue 0.016104 yes
Pileal_Stipeal_center DIF_gill_tissue 0.932826 no
Pileal_Stipeal_center YFB_stipe_center 0.718839 no
Pileal_Stipeal_center YFB_stipe_shell 0.473798 no
Pileal_Stipeal_center YFB_stipe_skin 0.981885 no
Pileal_Stipeal_center YFB_cap_skin 0.845446 no
Pileal_Stipeal_center YFB_cap_tissue 0.769188 no
Pileal_Stipeal_center YFB_gill_tissue 0.970902 no
Pileal_Stipeal_center YFB_veil 0.901469 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.974729 no
Pileal_Stipeal_center DIF_stipe_center 0.939815 no
Pileal_Stipeal_center DIF_stipe_shell 0.764874 no
Pileal_Stipeal_center DIF_stipe_skin 0.618958 no
Pileal_Stipeal_center DIF_cap_skin 0.851030 no
Pileal_Stipeal_center DIF_cap_tissue 0.615255 no
Pileal_Stipeal_shell DIF_gill_tissue 0.959699 no
Pileal_Stipeal_shell YFB_stipe_center 0.674636 no
Pileal_Stipeal_shell YFB_stipe_shell 0.428091 no
Pileal_Stipeal_shell YFB_stipe_skin 0.992076 no
Pileal_Stipeal_shell YFB_cap_skin 0.879110 no
Pileal_Stipeal_shell YFB_cap_tissue 0.725192 no
Pileal_Stipeal_shell YFB_gill_tissue 0.996364 no
Pileal_Stipeal_shell YFB_veil 0.929381 no
Pileal_Stipeal_shell DIF_stipe_center 0.966584 no
Pileal_Stipeal_shell DIF_stipe_shell 0.719362 no
Pileal_Stipeal_shell DIF_stipe_skin 0.571614 no
Pileal_Stipeal_shell DIF_cap_skin 0.885455 no
Pileal_Stipeal_shell DIF_cap_tissue 0.656621 no
DIF_stipe_center DIF_gill_tissue 0.992616 no
DIF_stipe_center YFB_stipe_center 0.628545 no
DIF_stipe_center YFB_stipe_shell 0.392751 no
DIF_stipe_center YFB_stipe_skin 0.959748 no
DIF_stipe_center YFB_cap_skin 0.924025 no
DIF_stipe_center YFB_cap_tissue 0.680859 no
DIF_stipe_center YFB_gill_tissue 0.971048 no
DIF_stipe_center YFB_veil 0.967720 no
DIF_stipe_center DIF_stipe_shell 0.673848 no
DIF_stipe_center DIF_stipe_skin 0.531625 no
DIF_stipe_center DIF_cap_skin 0.928947 no
DIF_stipe_center DIF_cap_tissue 0.723655 no
DIF_stipe_shell DIF_gill_tissue 0.665022 no
DIF_stipe_shell YFB_stipe_center 0.973927 no
DIF_stipe_shell YFB_stipe_shell 0.791928 no
DIF_stipe_shell YFB_stipe_skin 0.742323 no
DIF_stipe_shell YFB_cap_skin 0.544627 no
DIF_stipe_shell YFB_cap_tissue 0.997593 no
DIF_stipe_shell YFB_gill_tissue 0.726111 no
DIF_stipe_shell YFB_veil 0.617037 no
DIF_stipe_shell DIF_stipe_skin 0.904332 no
DIF_stipe_shell DIF_cap_skin 0.550808 no
DIF_stipe_shell DIF_cap_tissue 0.318509 no
DIF_stipe_skin DIF_gill_tissue 0.516552 no
DIF_stipe_skin YFB_stipe_center 0.933808 no
DIF_stipe_skin YFB_stipe_shell 0.919509 no
DIF_stipe_skin YFB_stipe_skin 0.592573 no
DIF_stipe_skin YFB_cap_skin 0.403989 no
DIF_stipe_skin YFB_cap_tissue 0.903581 no
DIF_stipe_skin YFB_gill_tissue 0.577809 no
DIF_stipe_skin YFB_veil 0.472104 no
DIF_stipe_skin DIF_cap_skin 0.410792 no
DIF_stipe_skin DIF_cap_tissue 0.219517 no
DIF_cap_skin DIF_gill_tissue 0.936192 no
DIF_cap_skin YFB_stipe_center 0.505843 no
DIF_cap_skin YFB_stipe_shell 0.285035 no
DIF_cap_skin YFB_stipe_skin 0.878836 no
DIF_cap_skin YFB_cap_skin 0.996731 no
DIF_cap_skin YFB_cap_tissue 0.557090 no
DIF_cap_skin YFB_gill_tissue 0.893575 no
DIF_cap_skin YFB_veil 0.964918 no
DIF_cap_skin DIF_cap_tissue 0.831933 no
DIF_cap_tissue DIF_gill_tissue 0.735768 no
DIF_cap_tissue YFB_stipe_center 0.281644 no
DIF_cap_tissue YFB_stipe_shell 0.134148 no
DIF_cap_tissue YFB_stipe_skin 0.654041 no
DIF_cap_tissue YFB_cap_skin 0.836713 no
DIF_cap_tissue YFB_cap_tissue 0.326142 no
DIF_cap_tissue YFB_gill_tissue 0.677908 no
DIF_cap_tissue YFB_veil 0.777850 no

Orthologs

Orthofinder run ID1
Orthogroup12175
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|027250
Agaricus bisporus var bisporus H97 AgabiH97|027250 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027250
MAFFPTCATYVLYLVALLRVLAAKVLGHSKREARRRSTRSRRSTLDKHDLEANITTTSAIELGLNTLGKYEKDTK
MTDSDLEFEAFIGQVKLPIDDSRKPAICEDHILPLYHIPSPKSPSVPLLDPLSETQPPPYHQVSLNNPDDVSSRI
MEASGFRGYEEPTNGRMIFARGLQFTENNNFQFPASFFSSLRSRSPKSQRRFRMKPKVNQIPANAIPVYLVKRSS
MSNTNNNTPRRRSNSNNGTLPTTPTTPGSPNLPLSPFPASNPSGSSLASSCANTPTHEIDMASLPSWRRDPNRAK
FIFGSLAKGASTAGVISSSSSSNSSSPSSPTRVGRGNGKKGVVIVESVVGERASQIVAESGFEVGFENVIIGMGL
TPPPTPTHAPISAMTPPSSIAAPATVTADTAPPPSPSANTSKLKVESGKKSGRGTSSSRRSRESIMKDVLSWVQN
SSLAV*
Coding >AgabiH97|027250
ATGGCTTTCTTCCCGACTTGTGCGACTTACGTTCTCTACCTGGTTGCCTTACTTCGGGTGCTCGCTGCGAAGGTT
CTTGGACACTCCAAAAGAGAGGCTAGGAGGCGGTCTACTCGGTCTAGGCGGTCTACACTTGATAAGCATGACTTG
GAGGCGAACATCACTACTACTTCTGCTATCGAACTAGGCTTGAATACTCTGGGGAAATACGAAAAGGACACAAAG
ATGACAGATTCTGATCTCGAGTTCGAAGCCTTCATCGGACAAGTCAAGCTTCCTATCGACGATTCTAGAAAACCC
GCTATCTGCGAGGACCATATATTACCGCTCTATCATATTCCATCACCCAAGTCACCTTCTGTGCCTCTACTGGAT
CCGCTCTCGGAAACTCAGCCTCCTCCGTATCACCAAGTCAGCCTCAACAATCCCGATGACGTCTCCTCTCGGATT
ATGGAAGCCTCCGGCTTCCGGGGCTATGAAGAACCGACGAATGGGCGAATGATATTCGCAAGGGGTCTTCAATTC
ACCGAAAATAACAATTTCCAATTTCCTGCTAGCTTCTTTTCGTCGCTTCGATCGAGATCTCCCAAATCACAACGT
CGCTTCAGAATGAAACCTAAAGTCAATCAGATTCCAGCCAACGCTATACCCGTCTACTTGGTGAAACGATCCTCG
ATGAGTAATACGAATAACAATACTCCCCGGCGTAGATCAAACAGCAATAACGGAACTTTACCAACGACGCCGACA
ACACCTGGATCACCTAATCTTCCATTGTCACCATTTCCTGCATCCAACCCTTCCGGGTCTTCACTTGCCTCGTCT
TGCGCCAATACACCCACACATGAAATCGATATGGCTAGTTTACCCAGCTGGCGAAGGGATCCTAATCGAGCGAAA
TTCATTTTCGGATCTCTTGCTAAAGGTGCTAGTACCGCTGGCGTTATTTCTTCTTCCTCGTCTTCGAATAGTTCA
TCACCGTCGTCGCCAACACGTGTTGGAAGAGGAAATGGCAAAAAAGGCGTTGTTATAGTTGAGAGTGTGGTTGGT
GAACGTGCTTCACAAATCGTCGCGGAAAGTGGATTCGAAGTTGGATTTGAGAATGTGATTATTGGTATGGGTTTG
ACTCCACCGCCGACACCTACACATGCTCCTATTTCTGCTATGACACCTCCGAGTTCTATTGCTGCTCCGGCTACT
GTTACTGCTGATACGGCCCCTCCTCCATCTCCTTCCGCGAATACTTCGAAACTCAAGGTTGAAAGCGGCAAGAAA
TCTGGTCGCGGTACATCTAGTTCAAGGAGGAGTCGCGAATCGATCATGAAGGATGTGTTATCTTGGGTTCAGAAT
TCTTCTCTTGCAGTATGA
Transcript >AgabiH97|027250
ATGGCTTTCTTCCCGACTTGTGCGACTTACGTTCTCTACCTGGTTGCCTTACTTCGGGTGCTCGCTGCGAAGGTT
CTTGGACACTCCAAAAGAGAGGCTAGGAGGCGGTCTACTCGGTCTAGGCGGTCTACACTTGATAAGCATGACTTG
GAGGCGAACATCACTACTACTTCTGCTATCGAACTAGGCTTGAATACTCTGGGGAAATACGAAAAGGACACAAAG
ATGACAGATTCTGATCTCGAGTTCGAAGCCTTCATCGGACAAGTCAAGCTTCCTATCGACGATTCTAGAAAACCC
GCTATCTGCGAGGACCATATATTACCGCTCTATCATATTCCATCACCCAAGTCACCTTCTGTGCCTCTACTGGAT
CCGCTCTCGGAAACTCAGCCTCCTCCGTATCACCAAGTCAGCCTCAACAATCCCGATGACGTCTCCTCTCGGATT
ATGGAAGCCTCCGGCTTCCGGGGCTATGAAGAACCGACGAATGGGCGAATGATATTCGCAAGGGGTCTTCAATTC
ACCGAAAATAACAATTTCCAATTTCCTGCTAGCTTCTTTTCGTCGCTTCGATCGAGATCTCCCAAATCACAACGT
CGCTTCAGAATGAAACCTAAAGTCAATCAGATTCCAGCCAACGCTATACCCGTCTACTTGGTGAAACGATCCTCG
ATGAGTAATACGAATAACAATACTCCCCGGCGTAGATCAAACAGCAATAACGGAACTTTACCAACGACGCCGACA
ACACCTGGATCACCTAATCTTCCATTGTCACCATTTCCTGCATCCAACCCTTCCGGGTCTTCACTTGCCTCGTCT
TGCGCCAATACACCCACACATGAAATCGATATGGCTAGTTTACCCAGCTGGCGAAGGGATCCTAATCGAGCGAAA
TTCATTTTCGGATCTCTTGCTAAAGGTGCTAGTACCGCTGGCGTTATTTCTTCTTCCTCGTCTTCGAATAGTTCA
TCACCGTCGTCGCCAACACGTGTTGGAAGAGGAAATGGCAAAAAAGGCGTTGTTATAGTTGAGAGTGTGGTTGGT
GAACGTGCTTCACAAATCGTCGCGGAAAGTGGATTCGAAGTTGGATTTGAGAATGTGATTATTGGTATGGGTTTG
ACTCCACCGCCGACACCTACACATGCTCCTATTTCTGCTATGACACCTCCGAGTTCTATTGCTGCTCCGGCTACT
GTTACTGCTGATACGGCCCCTCCTCCATCTCCTTCCGCGAATACTTCGAAACTCAAGGTTGAAAGCGGCAAGAAA
TCTGGTCGCGGTACATCTAGTTCAAGGAGGAGTCGCGAATCGATCATGAAGGATGTGTTATCTTGGGTTCAGAAT
TCTTCTCTTGCAGTATGA
Gene >AgabiH97|027250
ATGGCTTTCTTCCCGACTTGTGCGACTTACGTTCTCTACCTGGTTGCCTTACTTCGGGTGCTCGCTGCGAAGGTT
CTTGGACACTCCAAAAGAGAGGCTAGGAGGCGGTCTACTCGGTCTAGGCGGTCTACACTTGATAAGCATGACTTG
GAGGCGAACATCACTACTACTTCTGCTATCGAACTAGGCTTGAATACTCTGGGGAAATACGAAAAGGACACAAAG
ATGACAGATTCTGATCTCGAGTTCGAAGCCTTCATCGGACAAGTCAAGCTTCCTATCGACGATTCTAGAAAACCC
GCTATCTGCGAGGACCATATATTACCGCTCTATCATATTCCATCACCCAAGTCACCTTCTGTGCCTCTACTGGAT
CCGCTCTCGGAAACTCAGCCTCCTCCGTATCACCAAGTCAGCCTCAACAATCCCGATGACGTCTCCTCTCGGATT
ATGGAAGCCTCCGGCTTCCGGGGCTATGAAGAACCGACGAATGGGCGAATGATATTCGCAAGGGGTCTTCAATTC
ACCGAAAATAACAGTACGCACTTGAATCTCTCCTTTCTCACATACAATCATTCCGTTTTTTTTTAGATTTCCAAT
TTCCTGCTAGCTTCTTTTCGTCGCTTCGATCGAGATCTCCCAAATCACAACGTCGCTTCAGAATGAAACCTAAAG
TCAATCAGATTCCAGCCAACGCTATACCCGTCTACTTGGTGAAACGATCCTCGATGAGTAATACGAATAACAATA
CTCCCCGGCGTAGATCAAACAGCAATAACGGAACTTTACCAACGACGCCGACAACACCTGGATCACCTAATCTTC
CATTGTCACCATTTCCTGCATCCAACCCTTCCGGGTCTTCACTTGCCTCGTCTTGCGCCAATACACCCACACATG
AAATCGATATGGCTAGTTTACCCAGCTGGCGAAGGGATCCTAATCGAGCGAAATTCATTTTCGGATCTCTTGCTA
AAGGTGCTAGTACCGCTGGCGTTATTTCTTCTTCCTCGTCTTCGAATAGTTCATCACCGTCGTCGCCAACACGTG
TTGGAAGAGGAAATGGCAAAAAAGGCGTTGTTATAGTTGAGAGTGTGGTTGGTGAACGTGCTTCACAAATCGTCG
CGGAAAGTGGATTCGAAGTTGGATTTGAGAATGTGATTATTGGTATGGGTTTGACTCCACCGCCGACACCTACAC
ATGCTCCTATTTCTGCTATGACACCTCCGAGTTCTATTGCTGCTCCGGCTACTGTTACTGCTGATACGGCCCCTC
CTCCATCTCCTTCCGCGAATACTTCGAAACTCAAGGTTGAAAGCGGCAAGAAATCTGGTCGCGGTACATCTAGTT
CAAGGAGGAGTCGCGAATCGATCATGAAGGATGTGTTATCTTGGGTTCAGAATTCTTCTCTTGCAGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail