Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027150
Gene name
Locationscaffold_11:1447609..1450888
Strand-
Gene length (bp)3279
Transcript length (bp)3075
Coding sequence length (bp)3075
Protein length (aa) 1025

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02992 Transposase_21 Transposase family tnp2 5.8E-25 377 563

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027150
MQSEPTEKPSHKVRCTCGCGKHVAYSTRRAHIRLQTRTGVAASSIEQFGLGQRPDISIEVQRKRRRSVLTDEEEQ
PNTRRFVTPEIPDINEFGVGDQQMFVHQGIGSSAESIVERNQLAINTRWGTQNDIQAIEDSSDDGTEGDNENMRR
DERDYGDDEIGVEGEESGNTSEDRDEEEEEDTRTDTDGAGSVIAGTTQTSLWNDDAEFTDVFPSADPTLSEADLS
LLRKYALKIEEHITERTFAKFACAFPSVHHDSLKITKKHVRYLSGFNPVSYGCCVNSCICFVGPHEALTECPKCQ
EKRLDDRGKPRKSFVYIPLIPRLQAMVANRHHAGLMRYRADFEPQPGIITDIFDGSYYLSLLNTVVPASGDHPFF
YFSDERDIALGLSTDGFSPFKRRDKTCWPILLFNYNLSPEIRFHKKYSINVGTIPGPKKPSDLDSFLWPLVQELH
QLEFGVKSFDAITRSSFQLHAYLLLVFGDIPAMAMVMRMKGSNGISPCRVCKITGVCSNHSHTHYVPLRRDQVQY
AGPPRYDAAQLPLRVHDELMEQARVVQNAPNQATSDRLSKEYGIKGVPVLSTISSISFPASFPFDFMHLIWENLI
PNLILFWTSSFKALDHTGRGYVINTNDWKEIGARTVDSKSTIPSAFGAPIPNIAMQQGQMTSEMYSNWTLFVAPV
LLCGRFKQPQYYTHFMRLVELLKMCLEYEIDAEMLDQIDVGFQSWVEDYERLYYAHELDRLSACPLTLHALLRIA
WGIRVAGPVWAYWAFPMERHCNTLLPSIRSRRHPYAAINTFVSAMAQLDQIRLRFNLQSELDLSPERLTTLPTYV
SDSYSSYQLRSPRRQECIPVHLRDKLYASLATRFEKEKATVQAAISLDEPVIQYGRVSVLGGGDTIVAHDMVRRS
EDSRDSSYIKYIQMVDKYAHQRNRAPEYVKRTFFGQLLRIIVLDLPPTPQLGLDTRSTVIYAVVQAVKARIKKLS
PESNGYYYQQTGVVEIVDLSTVKSVVGRVQDGNRWFIVDRSSISAPQVD*
Coding >AgabiH97|027150
ATGCAATCTGAACCAACCGAAAAACCAAGCCATAAAGTCAGATGCACATGCGGCTGCGGCAAACATGTTGCATAT
TCTACGAGGAGAGCTCACATCAGACTACAGACCAGAACTGGAGTTGCGGCATCCTCCATAGAACAATTTGGTTTG
GGGCAGCGGCCAGATATCAGCATTGAGGTCCAAAGGAAGCGGCGGCGATCAGTTTTAACAGATGAAGAAGAGCAA
CCAAACACAAGGCGGTTCGTTACACCAGAAATCCCTGATATAAACGAATTTGGAGTTGGGGATCAGCAAATGTTC
GTCCATCAAGGCATTGGCTCATCTGCAGAATCAATTGTCGAGAGAAATCAGCTGGCAATCAATACCCGTTGGGGG
ACACAGAATGACATACAGGCAATTGAAGACTCAAGTGACGATGGAACTGAAGGAGACAATGAAAATATGAGACGT
GACGAAAGGGATTACGGTGATGATGAGATTGGAGTAGAGGGCGAAGAGAGTGGAAACACCTCTGAAGACAGAGAT
GAAGAGGAAGAAGAAGATACTAGGACTGACACCGATGGTGCTGGTTCTGTTATTGCTGGCACTACCCAGACTTCA
CTGTGGAATGATGATGCCGAGTTCACCGATGTTTTTCCATCTGCAGACCCTACCTTGAGTGAAGCGGACCTTAGC
CTATTGCGCAAATACGCTTTAAAAATTGAGGAGCACATAACGGAGAGGACATTCGCAAAGTTTGCTTGTGCTTTC
CCCAGCGTCCACCACGATTCCCTCAAAATTACAAAGAAACATGTCCGATACCTCTCAGGTTTTAATCCGGTCTCA
TATGGCTGTTGCGTAAACAGCTGTATCTGCTTTGTTGGACCACACGAAGCTCTGACTGAATGCCCCAAGTGCCAA
GAGAAGAGGCTCGATGATAGAGGCAAACCACGGAAATCCTTTGTCTACATTCCGTTGATCCCACGTCTACAAGCC
ATGGTTGCCAATCGCCATCACGCTGGCTTAATGCGCTATCGGGCTGACTTTGAGCCCCAACCTGGGATCATCACC
GACATTTTTGATGGATCATACTACCTTTCATTGCTCAACACAGTTGTCCCTGCCAGTGGCGACCATCCTTTCTTC
TATTTTTCAGATGAACGTGATATAGCCCTCGGTCTCTCTACAGACGGTTTTTCTCCATTCAAGCGTCGCGATAAA
ACTTGTTGGCCAATCCTACTCTTCAACTATAATCTCTCACCTGAGATTCGCTTTCACAAGAAATATTCCATCAAT
GTCGGGACCATCCCGGGCCCGAAAAAGCCCTCAGATTTGGACTCCTTTCTCTGGCCTCTCGTTCAAGAGCTGCAT
CAACTTGAGTTTGGTGTTAAATCCTTTGATGCTATCACTCGATCGTCTTTCCAACTACATGCATATCTTCTCCTT
GTGTTTGGTGATATACCTGCCATGGCAATGGTGATGCGCATGAAGGGATCGAACGGAATAAGCCCATGCCGAGTA
TGCAAGATCACTGGTGTTTGTAGCAACCACAGCCACACCCACTATGTCCCCTTACGACGTGATCAAGTTCAATAT
GCTGGTCCTCCCAGATATGATGCTGCTCAACTACCACTTCGGGTACACGACGAATTGATGGAACAAGCCAGGGTA
GTACAGAATGCCCCGAATCAAGCAACATCTGACCGCCTGTCTAAGGAGTATGGGATTAAAGGGGTCCCCGTCCTC
AGCACCATATCATCAATATCATTTCCGGCATCATTTCCGTTCGATTTCATGCATCTCATATGGGAAAATTTAATT
CCTAATCTCATCTTATTCTGGACTTCCAGTTTCAAAGCATTGGATCATACGGGCAGGGGCTACGTTATCAATACC
AATGATTGGAAGGAAATCGGAGCTAGGACCGTAGATTCTAAATCCACTATACCATCAGCATTTGGAGCTCCCATA
CCCAACATCGCAATGCAACAAGGCCAAATGACATCTGAGATGTATTCTAACTGGACGTTGTTCGTAGCTCCTGTC
CTACTATGTGGCCGGTTCAAGCAACCACAATATTACACTCACTTTATGCGGCTTGTCGAATTACTCAAAATGTGC
TTGGAGTATGAAATCGATGCAGAGATGTTAGATCAGATTGACGTAGGTTTTCAGTCCTGGGTAGAGGACTATGAA
AGACTTTATTATGCTCATGAACTTGACCGGCTTTCTGCATGTCCTCTAACCCTTCACGCACTTCTTCGTATTGCA
TGGGGTATTAGAGTAGCTGGCCCCGTTTGGGCATACTGGGCATTTCCCATGGAGCGTCATTGCAACACCCTACTC
CCATCCATCAGAAGTCGACGTCATCCCTATGCAGCCATCAATACCTTTGTCTCTGCAATGGCGCAACTTGATCAA
ATCCGGCTTAGATTCAACCTGCAGTCAGAGCTGGATCTGAGTCCTGAAAGGCTAACTACATTGCCTACCTATGTC
TCAGATTCTTATTCATCTTATCAGCTTCGTTCTCCTCGACGACAGGAATGCATTCCTGTTCACCTCCGAGATAAG
CTGTACGCTTCGTTGGCAACAAGATTTGAAAAAGAGAAGGCAACTGTACAAGCTGCCATCAGCCTTGACGAGCCT
GTCATTCAGTATGGTAGAGTTTCTGTCCTTGGTGGTGGTGATACTATTGTGGCTCATGATATGGTTCGACGAAGC
GAGGATTCGAGGGACTCGTCCTATATTAAGTACATTCAAATGGTAGATAAATATGCTCATCAGAGAAACCGAGCG
CCTGAGTATGTGAAGAGAACTTTTTTTGGACAATTACTGCGCATCATTGTACTCGATCTACCACCAACCCCACAA
CTAGGACTGGACACTAGATCAACTGTGATCTATGCCGTTGTTCAAGCTGTCAAGGCACGGATCAAGAAGCTCAGT
CCAGAGAGCAACGGGTATTACTATCAACAAACAGGTGTAGTTGAGATTGTTGACTTAAGCACAGTAAAATCTGTA
GTTGGACGTGTGCAGGACGGAAACAGATGGTTCATTGTTGATCGAAGTAGCATTTCGGCACCTCAAGTAGACTAA
Transcript >AgabiH97|027150
ATGCAATCTGAACCAACCGAAAAACCAAGCCATAAAGTCAGATGCACATGCGGCTGCGGCAAACATGTTGCATAT
TCTACGAGGAGAGCTCACATCAGACTACAGACCAGAACTGGAGTTGCGGCATCCTCCATAGAACAATTTGGTTTG
GGGCAGCGGCCAGATATCAGCATTGAGGTCCAAAGGAAGCGGCGGCGATCAGTTTTAACAGATGAAGAAGAGCAA
CCAAACACAAGGCGGTTCGTTACACCAGAAATCCCTGATATAAACGAATTTGGAGTTGGGGATCAGCAAATGTTC
GTCCATCAAGGCATTGGCTCATCTGCAGAATCAATTGTCGAGAGAAATCAGCTGGCAATCAATACCCGTTGGGGG
ACACAGAATGACATACAGGCAATTGAAGACTCAAGTGACGATGGAACTGAAGGAGACAATGAAAATATGAGACGT
GACGAAAGGGATTACGGTGATGATGAGATTGGAGTAGAGGGCGAAGAGAGTGGAAACACCTCTGAAGACAGAGAT
GAAGAGGAAGAAGAAGATACTAGGACTGACACCGATGGTGCTGGTTCTGTTATTGCTGGCACTACCCAGACTTCA
CTGTGGAATGATGATGCCGAGTTCACCGATGTTTTTCCATCTGCAGACCCTACCTTGAGTGAAGCGGACCTTAGC
CTATTGCGCAAATACGCTTTAAAAATTGAGGAGCACATAACGGAGAGGACATTCGCAAAGTTTGCTTGTGCTTTC
CCCAGCGTCCACCACGATTCCCTCAAAATTACAAAGAAACATGTCCGATACCTCTCAGGTTTTAATCCGGTCTCA
TATGGCTGTTGCGTAAACAGCTGTATCTGCTTTGTTGGACCACACGAAGCTCTGACTGAATGCCCCAAGTGCCAA
GAGAAGAGGCTCGATGATAGAGGCAAACCACGGAAATCCTTTGTCTACATTCCGTTGATCCCACGTCTACAAGCC
ATGGTTGCCAATCGCCATCACGCTGGCTTAATGCGCTATCGGGCTGACTTTGAGCCCCAACCTGGGATCATCACC
GACATTTTTGATGGATCATACTACCTTTCATTGCTCAACACAGTTGTCCCTGCCAGTGGCGACCATCCTTTCTTC
TATTTTTCAGATGAACGTGATATAGCCCTCGGTCTCTCTACAGACGGTTTTTCTCCATTCAAGCGTCGCGATAAA
ACTTGTTGGCCAATCCTACTCTTCAACTATAATCTCTCACCTGAGATTCGCTTTCACAAGAAATATTCCATCAAT
GTCGGGACCATCCCGGGCCCGAAAAAGCCCTCAGATTTGGACTCCTTTCTCTGGCCTCTCGTTCAAGAGCTGCAT
CAACTTGAGTTTGGTGTTAAATCCTTTGATGCTATCACTCGATCGTCTTTCCAACTACATGCATATCTTCTCCTT
GTGTTTGGTGATATACCTGCCATGGCAATGGTGATGCGCATGAAGGGATCGAACGGAATAAGCCCATGCCGAGTA
TGCAAGATCACTGGTGTTTGTAGCAACCACAGCCACACCCACTATGTCCCCTTACGACGTGATCAAGTTCAATAT
GCTGGTCCTCCCAGATATGATGCTGCTCAACTACCACTTCGGGTACACGACGAATTGATGGAACAAGCCAGGGTA
GTACAGAATGCCCCGAATCAAGCAACATCTGACCGCCTGTCTAAGGAGTATGGGATTAAAGGGGTCCCCGTCCTC
AGCACCATATCATCAATATCATTTCCGGCATCATTTCCGTTCGATTTCATGCATCTCATATGGGAAAATTTAATT
CCTAATCTCATCTTATTCTGGACTTCCAGTTTCAAAGCATTGGATCATACGGGCAGGGGCTACGTTATCAATACC
AATGATTGGAAGGAAATCGGAGCTAGGACCGTAGATTCTAAATCCACTATACCATCAGCATTTGGAGCTCCCATA
CCCAACATCGCAATGCAACAAGGCCAAATGACATCTGAGATGTATTCTAACTGGACGTTGTTCGTAGCTCCTGTC
CTACTATGTGGCCGGTTCAAGCAACCACAATATTACACTCACTTTATGCGGCTTGTCGAATTACTCAAAATGTGC
TTGGAGTATGAAATCGATGCAGAGATGTTAGATCAGATTGACGTAGGTTTTCAGTCCTGGGTAGAGGACTATGAA
AGACTTTATTATGCTCATGAACTTGACCGGCTTTCTGCATGTCCTCTAACCCTTCACGCACTTCTTCGTATTGCA
TGGGGTATTAGAGTAGCTGGCCCCGTTTGGGCATACTGGGCATTTCCCATGGAGCGTCATTGCAACACCCTACTC
CCATCCATCAGAAGTCGACGTCATCCCTATGCAGCCATCAATACCTTTGTCTCTGCAATGGCGCAACTTGATCAA
ATCCGGCTTAGATTCAACCTGCAGTCAGAGCTGGATCTGAGTCCTGAAAGGCTAACTACATTGCCTACCTATGTC
TCAGATTCTTATTCATCTTATCAGCTTCGTTCTCCTCGACGACAGGAATGCATTCCTGTTCACCTCCGAGATAAG
CTGTACGCTTCGTTGGCAACAAGATTTGAAAAAGAGAAGGCAACTGTACAAGCTGCCATCAGCCTTGACGAGCCT
GTCATTCAGTATGGTAGAGTTTCTGTCCTTGGTGGTGGTGATACTATTGTGGCTCATGATATGGTTCGACGAAGC
GAGGATTCGAGGGACTCGTCCTATATTAAGTACATTCAAATGGTAGATAAATATGCTCATCAGAGAAACCGAGCG
CCTGAGTATGTGAAGAGAACTTTTTTTGGACAATTACTGCGCATCATTGTACTCGATCTACCACCAACCCCACAA
CTAGGACTGGACACTAGATCAACTGTGATCTATGCCGTTGTTCAAGCTGTCAAGGCACGGATCAAGAAGCTCAGT
CCAGAGAGCAACGGGTATTACTATCAACAAACAGGTGTAGTTGAGATTGTTGACTTAAGCACAGTAAAATCTGTA
GTTGGACGTGTGCAGGACGGAAACAGATGGTTCATTGTTGATCGAAGTAGCATTTCGGCACCTCAAGTAGACTAA
Gene >AgabiH97|027150
ATGCAATCTGAACCAACCGAAAAACCAAGCCATAAAGTCAGATGCACATGCGGCTGCGGCAAACATGTTGCATAT
TCTACGAGGAGAGCTCACATCAGACTACAGACCAGAACTGGAGTTGCGGCATCCTCCATAGAACAATTTGGTTTG
GGGCAGCGGCCAGATATCAGCATTGAGGTCCAAAGGAAGCGGCGGCGATCAGTTTTAACAGATGAAGAAGAGCAA
CCAAACACAAGGCGGTTCGTTACACCAGAAATCCCTGATATAAACGAATTTGGAGTTGGGGATCAGCAAATGTTC
GTCCATCAAGGCATTGGCTCATCTGCAGAATCAATTGTCGAGAGAAATCAGCTGGCAATCAATACCCGTTGGGGG
ACACAGAATGACATACAGGCAATTGAAGACTCAAGTGACGATGGAACTGAAGGAGACAATGAAAATATGAGACGT
GACGAAAGGGATTACGGTGATGATGAGATTGGAGTAGAGGGCGAAGAGAGTGGAAACACCTCTGAAGACAGAGAT
GAAGAGGAAGAAGAAGATACTAGGACTGACACCGATGGTGCTGGTTCTGTTATTGCTGGCACTACCCAGACTTCA
CTGTGGAATGATGATGCCGAGTTCACCGATGTTTTTCCATCTGCAGGTTCATCATCTTTTGCTACATTCACAATT
CCTGCTAACGATGCGTCGATGATCCAGACCCTACCTTGAGTGAAGCGGACCTTAGCCTATTGCGCAAATACGCTT
TAAAAATTGAGGAGCACATAACGGAGAGGACATTCGCAAAGTTTGCTTGTGCTTTCCCCAGCGTCCACCACGATT
CCCTCAAAATTACAAAGAAACATGTCCGATACCTCTCAGGTTTTAATCCGGTCTCATATGGCTGTTGCGTAAACA
GCTGTATCTGCTTTGTTGGACCACACGAAGCTCTGACTGAATGCCCCAAGTGCCAAGAGAAGAGGCTCGATGATA
GAGGCAAACCACGGAAATCCTTTGTCTACATTCCGTTGATCCCACGTCTACAAGCCATGGTTGCCAATCGCCATC
ACGCTGGCTTAATGCGCTATCGGGCTGACTTTGAGCCCCAACCTGGGATCATCACCGACATTTTTGATGGATCAT
ACTACCTTTCATTGCTCAACACAGTTGTCCCTGCCAGTGGCGACCATCCTTTCTTCTATTTTTCAGATGAACGTG
ATATAGCCCTCGGTCTCTCTACAGACGGTTTTTCTCCATTCAAGCGTCGCGATAAAACTTGTTGGCCAATCCTAC
TCTTCAACTATAATCTCTCACCTGAGATTCGCTTTCACAAGAAATATTCCATCAATGTCGGGACCATCCCGGGCC
CGAAAAAGCCCTCAGATTTGGACTCCTTTCTCTGGCCTCTCGTTCAAGAGCTGCATCAACTTGAGTTTGGTGTTA
AATCCTTTGATGCTATCACTCGATCGTCTTTCCAACTACATGCATATCTTCTCCTTGTGTTTGGTGATATACCTG
CCATGGCAATGGTGATGCGCATGAAGGGATCGAACGGAATAAGCCCATGCCGAGTATGCAAGATCACTGGTGTTT
GTAGCAACCACAGCCACACCCACTATGTCCCCTTACGACGTGATCAAGTTCAATATGCTGGTCCTCCCAGATATG
ATGCTGCTCAACTACCACTTCGGGTACACGACGAATTGATGGAACAAGCCAGGGTAGTACAGAATGCCCCGAATC
AAGCAACATCTGACCGCCTGTCTAAGGAGTATGGGATTAAAGGGGTCCCCGTCCTCAGCACCATATCATCAATAT
CATTTCCGGCATCATTTCCGTTCGATTTCATGCATCTCATATGGGAAAATTTAATTCCTAATCTCATCTTATTCT
GGACTTCCAGTTTCAAAGCATTGGATCATACGGGCAGGGGCTACGTTATCAATACCAATGATTGGAAGGAAATCG
GAGCTAGGACCGTAGATTCTAAATCCACTATACCATCAGCATTTGGAGCTCCCATACCCAACATCGCAATGCAAC
AAGGCCAAATGACATCTGAGATGTATTCTAACTGGACGTTGTTCGTAGCTCCTGTCCTACTATGTGGCCGGTTCA
AGCAACCACAATATTACACTCACTTTATGCGGCTTGTCGAATTACTCAAAATGTGCTTGGAGTATGAAATCGATG
CAGAGATGTTAGATCAGATTGACGTAGGTTTTCAGTCCTGGGTAGAGGACTATGAAAGGTAAGTCAAGAGATCCA
TATGTCGCTTCTACGGAACTCAAAGTGATATAGACTTTATTATGCTCATGAACTTGACCGGCTTTCTGCATGTCC
TCTAACCCTTCACGCACTTCTTCGTATTGCATGGGGTATTAGAGTAGCTGGCCCCGTTTGGGCATACTGGGCATT
TCCCATGGAGCGTCATTGCAACACCCTACTCCCATCCATCAGAAGTCGACGTCATCCCTATGCAGCCATCAATAC
CTTTGTCTCTGCAATGGCGCAACTTGATCAAATCCGGCTTAGATTCAACCTGCAGTCAGAGCTGGATCTGAGTCC
TGAAAGGCTAACTACATTGCCTACCTATGTCTCAGATTCTTGTACGTCTTTATCATCTGATATTGGATAATGACT
CATCTGCACTGTAGATTCATCTTATCAGCTTCGTTCTCCTCGACGACAGGAATGCATTCCTGTTCACCTCCGAGA
TAAGCTGTACGCTTCGTTGGCAACAAGATTTGAAAAAGAGAAGGCAACTGTACAAGCTGCCATCAGCCTTGACGA
GCCTGTCATTCAGTATGGTAGAGTTTCTGTCCTTGGTGGTGGTGATACTATTGTGGCTCATGATATGGTTCGACG
AAGCGAGGATTCGAGGGACTCGTCCTATATTAAGGTAAGCATTTTGTCGAATTTGTGGTTCTAATCCTGATTTTC
ATCATTCAGTACATTCAAATGGTAGATAAATATGCTCATCAGAGAAACCGAGCGCCTGAGTATGTGAAGAGAACT
TTTTTTGGACAATTACTGCGCATCATTGTACTCGATCTACCACCAACCCCACAACTAGGACTGGACACTAGATCA
ACTGTGATCTATGCCGTTGTTCAAGCTGTCAAGGCACGGATCAAGAAGCTCAGTCCAGAGAGCAACGGGTATTAC
TATCAACAAACAGGTGTAGTTGAGATTGTTGACTTAAGCACAGTAAAATCTGTAGTTGGACGTGTGCAGGACGGA
AACAGATGGTTCATTGTTGATCGAAGTAGCATTTCGGCACCTCAAGTAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail