Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027080
Gene name
Locationscaffold_11:1407966..1409704
Strand-
Gene length (bp)1738
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14308 DnaJ-X X-domain of DnaJ-containing 8.9E-50 255 449
PF00226 DnaJ DnaJ domain 2.4E-25 103 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 97 455 2.0E-59
sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 99 440 4.0E-59
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 98 453 6.0E-54
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 100 445 2.0E-49
sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 100 479 4.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 97 455 2.0E-59
sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 99 440 4.0E-59
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 98 453 6.0E-54
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 100 445 2.0E-49
sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 100 479 4.0E-31
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 103 190 2.0E-18
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 103 213 3.0E-18
sp|B1WVR2|DNAJ_CYAA5 Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1 103 177 3.0E-18
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 103 190 4.0E-18
sp|Q6XL73|DNJ39_ARATH Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2 104 174 5.0E-18
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 103 208 6.0E-18
sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 103 200 7.0E-18
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 103 167 8.0E-18
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 103 208 8.0E-18
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 103 213 9.0E-18
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 103 213 1.0E-17
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 103 167 1.0E-17
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 103 167 1.0E-17
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 96 167 1.0E-17
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 103 167 1.0E-17
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 103 167 1.0E-17
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 103 167 2.0E-17
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 103 190 3.0E-17
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 103 167 3.0E-17
sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 103 189 3.0E-17
sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 103 189 3.0E-17
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 103 200 3.0E-17
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 103 167 5.0E-17
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 103 167 5.0E-17
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 99 167 6.0E-17
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 103 200 6.0E-17
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 103 167 6.0E-17
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 103 167 6.0E-17
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 103 167 7.0E-17
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 100 167 7.0E-17
sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 103 200 7.0E-17
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 103 167 7.0E-17
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 103 219 9.0E-17
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 103 167 9.0E-17
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 103 219 9.0E-17
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 103 167 1.0E-16
sp|P81999|DJB11_CANLF DnaJ homolog subfamily B member 11 OS=Canis lupus familiaris GN=DNAJB11 PE=1 SV=2 103 167 1.0E-16
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 103 167 1.0E-16
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 103 167 1.0E-16
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 103 167 1.0E-16
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 103 167 1.0E-16
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 103 167 1.0E-16
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 103 167 1.0E-16
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 103 190 2.0E-16
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 103 190 2.0E-16
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 103 174 2.0E-16
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 103 167 2.0E-16
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 103 167 2.0E-16
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 103 166 2.0E-16
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 103 189 2.0E-16
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 103 189 2.0E-16
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 103 166 2.0E-16
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 103 166 2.0E-16
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 103 188 2.0E-16
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 103 213 2.0E-16
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 103 167 3.0E-16
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 103 188 3.0E-16
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 103 190 3.0E-16
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 103 167 3.0E-16
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 103 167 3.0E-16
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 103 167 3.0E-16
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 103 167 3.0E-16
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 103 167 4.0E-16
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 103 191 4.0E-16
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 103 217 4.0E-16
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 99 223 4.0E-16
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 103 167 4.0E-16
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 103 190 4.0E-16
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 103 167 4.0E-16
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 70 190 5.0E-16
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 103 166 5.0E-16
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 103 191 6.0E-16
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 103 197 7.0E-16
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 103 167 8.0E-16
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 103 188 9.0E-16
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 103 167 9.0E-16
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 103 167 9.0E-16
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 103 167 9.0E-16
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 103 167 9.0E-16
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 103 167 9.0E-16
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 103 167 9.0E-16
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 103 189 1.0E-15
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 103 167 1.0E-15
sp|Q7VG06|DNAJ_HELHP Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaJ PE=3 SV=1 103 200 1.0E-15
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 103 167 2.0E-15
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 103 190 2.0E-15
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 103 192 2.0E-15
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 103 177 2.0E-15
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 103 177 2.0E-15
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 103 190 2.0E-15
sp|Q4FVQ7|DNAJ_PSYA2 Chaperone protein DnaJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaJ PE=3 SV=1 103 198 2.0E-15
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 103 192 2.0E-15
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 103 190 2.0E-15
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 103 190 2.0E-15
sp|O42196|DNJC5_XENLA DnaJ homolog subfamily C member 5 OS=Xenopus laevis GN=dnajc5 PE=2 SV=1 104 167 2.0E-15
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 103 200 2.0E-15
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 100 193 2.0E-15
sp|B0S1F7|DNAJ_FINM2 Chaperone protein DnaJ OS=Finegoldia magna (strain ATCC 29328) GN=dnaJ PE=3 SV=1 104 189 2.0E-15
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 103 200 2.0E-15
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 103 167 2.0E-15
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 103 200 3.0E-15
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 103 167 3.0E-15
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 103 167 3.0E-15
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 103 167 3.0E-15
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 99 167 3.0E-15
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 99 167 3.0E-15
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 100 196 3.0E-15
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 103 189 3.0E-15
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 103 213 3.0E-15
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 103 200 3.0E-15
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 103 213 4.0E-15
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 103 213 4.0E-15
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 103 167 4.0E-15
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 103 167 4.0E-15
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 103 218 4.0E-15
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 103 167 4.0E-15
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 103 167 4.0E-15
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 103 176 4.0E-15
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 103 227 4.0E-15
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 103 167 4.0E-15
sp|D2H417|DNJ5B_AILME DnaJ homolog subfamily C member 5B OS=Ailuropoda melanoleuca GN=DNAJC5B PE=3 SV=1 104 167 5.0E-15
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 98 167 5.0E-15
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 103 200 5.0E-15
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 103 200 5.0E-15
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 103 218 6.0E-15
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 103 174 6.0E-15
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 103 189 6.0E-15
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 103 185 6.0E-15
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 103 188 6.0E-15
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 103 190 6.0E-15
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 103 188 6.0E-15
sp|Q1QET5|DNAJ_PSYCK Chaperone protein DnaJ OS=Psychrobacter cryohalolentis (strain K5) GN=dnaJ PE=3 SV=1 103 198 7.0E-15
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 102 166 7.0E-15
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 102 166 7.0E-15
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 103 167 7.0E-15
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 103 189 7.0E-15
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 100 190 7.0E-15
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 103 167 8.0E-15
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 100 190 8.0E-15
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 100 190 8.0E-15
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 103 189 8.0E-15
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 103 167 8.0E-15
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 103 167 8.0E-15
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 100 167 8.0E-15
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 103 190 8.0E-15
sp|Q8KRC9|DNAJ_MYXXA Chaperone protein DnaJ OS=Myxococcus xanthus GN=dnaJ PE=3 SV=1 103 168 8.0E-15
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 103 167 8.0E-15
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 103 184 9.0E-15
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 103 167 9.0E-15
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 103 190 9.0E-15
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 103 227 9.0E-15
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 103 189 9.0E-15
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 103 167 9.0E-15
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 103 167 9.0E-15
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 103 167 1.0E-14
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 103 190 1.0E-14
sp|Q9QYI6|DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus GN=Dnajb9 PE=1 SV=2 103 167 1.0E-14
sp|B8DQW8|DNAJ_DESVM Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaJ PE=3 SV=1 103 200 1.0E-14
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 104 167 1.0E-14
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 104 167 1.0E-14
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 103 167 1.0E-14
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 86 167 1.0E-14
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 103 167 1.0E-14
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 103 167 1.0E-14
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 103 188 1.0E-14
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 104 167 1.0E-14
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 103 177 1.0E-14
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 104 167 1.0E-14
sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens GN=DNAJC5B PE=1 SV=2 104 167 1.0E-14
sp|Q03751|DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster GN=Csp PE=1 SV=1 90 167 1.0E-14
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 103 167 1.0E-14
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 103 167 1.0E-14
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 103 189 1.0E-14
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 103 227 1.0E-14
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 103 189 2.0E-14
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 99 167 2.0E-14
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 103 174 2.0E-14
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 103 188 2.0E-14
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 100 190 2.0E-14
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 100 190 2.0E-14
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 104 167 2.0E-14
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|P97554|DNJB9_RAT DnaJ homolog subfamily B member 9 OS=Rattus norvegicus GN=Dnajb9 PE=2 SV=2 103 167 2.0E-14
sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus musculus GN=Dnajc5b PE=1 SV=1 104 167 2.0E-14
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 103 190 2.0E-14
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 99 189 2.0E-14
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 103 192 2.0E-14
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 30 190 2.0E-14
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 100 189 2.0E-14
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 104 167 2.0E-14
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 103 167 2.0E-14
sp|Q114R3|DNAJ_TRIEI Chaperone protein DnaJ OS=Trichodesmium erythraeum (strain IMS101) GN=dnaJ PE=3 SV=1 103 190 2.0E-14
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 103 167 3.0E-14
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 103 167 3.0E-14
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 103 167 3.0E-14
sp|D3ZD82|DNJ5B_RAT DnaJ homolog subfamily C member 5B OS=Rattus norvegicus GN=Dnajc5b PE=1 SV=1 104 167 3.0E-14
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 103 167 3.0E-14
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 103 227 3.0E-14
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 103 189 3.0E-14
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 100 167 3.0E-14
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 103 189 3.0E-14
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 100 167 3.0E-14
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 103 167 3.0E-14
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 103 189 3.0E-14
sp|Q24331|TID_DROVI Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1 79 195 3.0E-14
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 103 167 3.0E-14
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 103 189 3.0E-14
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 103 166 4.0E-14
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 103 189 4.0E-14
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 103 189 4.0E-14
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 103 167 4.0E-14
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 103 167 4.0E-14
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 103 192 5.0E-14
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 103 190 5.0E-14
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 103 167 5.0E-14
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 103 189 5.0E-14
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 103 167 5.0E-14
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 103 190 5.0E-14
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 102 219 6.0E-14
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 103 189 6.0E-14
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 102 190 6.0E-14
sp|Q7V9C8|DNAJ_PROMM Chaperone protein DnaJ OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaJ PE=3 SV=1 103 166 6.0E-14
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 103 192 6.0E-14
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 103 192 6.0E-14
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 100 190 6.0E-14
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 100 190 6.0E-14
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 103 190 6.0E-14
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 103 190 6.0E-14
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 103 189 7.0E-14
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 103 188 7.0E-14
sp|B4SSQ7|DNAJ_STRM5 Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaJ PE=3 SV=1 103 189 7.0E-14
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 99 213 7.0E-14
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 103 167 7.0E-14
sp|Q4FNQ0|DNAJ_PELUB Chaperone protein DnaJ OS=Pelagibacter ubique (strain HTCC1062) GN=dnaJ PE=3 SV=1 103 167 7.0E-14
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 103 190 8.0E-14
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 103 192 8.0E-14
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 103 167 8.0E-14
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 103 228 8.0E-14
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 100 167 8.0E-14
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 103 192 9.0E-14
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 103 192 9.0E-14
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 103 192 9.0E-14
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 103 167 9.0E-14
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 100 166 9.0E-14
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 100 166 9.0E-14
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 99 213 9.0E-14
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 99 167 9.0E-14
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 103 167 1.0E-13
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 103 177 1.0E-13
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 103 192 1.0E-13
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 103 192 1.0E-13
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 103 167 1.0E-13
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 100 167 1.0E-13
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 101 184 1.0E-13
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 100 167 1.0E-13
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 103 176 1.0E-13
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 100 167 1.0E-13
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 103 167 1.0E-13
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 103 213 1.0E-13
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 103 189 1.0E-13
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 103 213 1.0E-13
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 103 175 1.0E-13
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 103 167 1.0E-13
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 103 213 1.0E-13
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 100 166 1.0E-13
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 100 166 1.0E-13
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 103 213 1.0E-13
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 103 190 2.0E-13
sp|Q5N0G1|DNAJ_SYNP6 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaJ PE=3 SV=1 103 166 2.0E-13
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 103 189 2.0E-13
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 103 192 2.0E-13
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 103 189 2.0E-13
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 103 218 2.0E-13
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 103 192 2.0E-13
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 103 192 2.0E-13
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 103 192 2.0E-13
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 103 192 2.0E-13
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 103 192 2.0E-13
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 103 216 2.0E-13
sp|P56101|DNJC5_TORCA DnaJ homolog subfamily C member 5 OS=Torpedo californica GN=dnajc5 PE=1 SV=1 104 167 2.0E-13
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 103 200 2.0E-13
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 103 200 2.0E-13
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 103 189 2.0E-13
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 103 189 2.0E-13
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 103 189 2.0E-13
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 103 189 2.0E-13
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 103 171 2.0E-13
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 103 167 2.0E-13
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 103 192 3.0E-13
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 103 192 3.0E-13
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 103 189 3.0E-13
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 103 189 3.0E-13
sp|Q75WD2|DNAJ_ACEP3 Chaperone protein DnaJ OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=dnaJ PE=3 SV=2 103 167 3.0E-13
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 30 190 3.0E-13
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 103 192 3.0E-13
sp|Q5YNI2|DNAJ2_NOCFA Chaperone protein DnaJ 2 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ2 PE=3 SV=1 99 165 3.0E-13
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 103 167 3.0E-13
sp|Q2JH49|DNAJ_SYNJB Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dnaJ PE=3 SV=1 103 190 4.0E-13
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 103 192 4.0E-13
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|B1XQF6|DNAJ_SYNP2 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1 103 188 4.0E-13
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 103 199 4.0E-13
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 103 195 4.0E-13
sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 63 193 4.0E-13
sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 96 167 4.0E-13
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 103 192 4.0E-13
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 103 167 4.0E-13
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 103 213 4.0E-13
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 103 190 4.0E-13
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 103 213 4.0E-13
sp|P50026|DNAJ_SYNE7 Chaperone protein DnaJ OS=Synechococcus elongatus (strain PCC 7942) GN=dnaJ PE=3 SV=2 103 166 4.0E-13
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 103 190 5.0E-13
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 103 192 5.0E-13
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 103 192 5.0E-13
sp|B7JY68|DNAJ_CYAP8 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 8801) GN=dnaJ PE=3 SV=1 103 166 5.0E-13
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 103 167 5.0E-13
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 103 190 5.0E-13
sp|Q4KIH0|DNAJ_PSEF5 Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaJ PE=3 SV=1 103 167 5.0E-13
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 103 192 5.0E-13
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 78 190 5.0E-13
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 103 167 5.0E-13
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 103 192 6.0E-13
sp|Q16D44|DNAJ_ROSDO Chaperone protein DnaJ OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaJ PE=3 SV=1 103 167 6.0E-13
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 103 167 6.0E-13
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 103 167 6.0E-13
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 103 167 6.0E-13
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 103 167 7.0E-13
sp|Q2JW78|DNAJ_SYNJA Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-3-3Ab) GN=dnaJ PE=3 SV=1 103 190 7.0E-13
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 103 167 7.0E-13
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 103 189 7.0E-13
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 103 189 7.0E-13
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 103 167 7.0E-13
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 103 190 7.0E-13
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 103 189 7.0E-13
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 103 189 7.0E-13
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 103 189 8.0E-13
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 103 189 8.0E-13
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 100 169 8.0E-13
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 103 167 8.0E-13
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 103 189 8.0E-13
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 103 190 8.0E-13
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 103 167 9.0E-13
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 103 190 9.0E-13
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 103 189 9.0E-13
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 103 177 9.0E-13
sp|Q8NLY8|DNAJ2_CORGL Chaperone protein DnaJ 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dnaJ2 PE=3 SV=1 103 166 9.0E-13
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 103 189 9.0E-13
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 99 188 1.0E-12
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 101 184 1.0E-12
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 103 190 1.0E-12
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 103 190 1.0E-12
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 103 213 1.0E-12
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 103 189 1.0E-12
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 103 191 1.0E-12
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 103 206 1.0E-12
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 103 186 1.0E-12
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 103 167 1.0E-12
sp|Q7VEJ6|DNAJ_PROMA Chaperone protein DnaJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaJ PE=3 SV=1 103 188 1.0E-12
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 100 169 2.0E-12
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 103 167 2.0E-12
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 103 215 2.0E-12
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 103 166 2.0E-12
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 100 169 2.0E-12
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 100 167 2.0E-12
sp|B0RVU1|DNAJ_XANCB Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|Q8PAK8|DNAJ_XANCP Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|Q4UT12|DNAJ_XANC8 Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 99 213 2.0E-12
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 100 167 2.0E-12
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 103 197 2.0E-12
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 103 213 2.0E-12
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 100 167 2.0E-12
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 103 189 2.0E-12
sp|P40170|DNAJ1_STRCO Chaperone protein DnaJ 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ1 PE=3 SV=2 99 165 2.0E-12
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 103 192 2.0E-12
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 99 192 2.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 103 169 2.0E-12
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 103 167 2.0E-12
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 103 167 3.0E-12
sp|C4Z1J3|DNAJ_EUBE2 Chaperone protein DnaJ OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaJ PE=3 SV=1 103 166 3.0E-12
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 103 190 3.0E-12
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 103 188 3.0E-12
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 103 167 3.0E-12
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 103 167 3.0E-12
sp|Q6NEZ1|DNAJ2_CORDI Chaperone protein DnaJ 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dnaJ2 PE=3 SV=1 100 166 3.0E-12
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 103 167 3.0E-12
sp|Q057X7|DNAJ_BUCCC Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dnaJ PE=3 SV=1 103 189 3.0E-12
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 103 167 3.0E-12
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 99 167 3.0E-12
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 103 168 3.0E-12
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 103 189 3.0E-12
sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 104 167 3.0E-12
sp|Q7UM96|DNAJ_RHOBA Chaperone protein DnaJ OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaJ PE=3 SV=1 100 186 4.0E-12
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 99 167 4.0E-12
sp|P73097|DNAJ2_SYNY3 Chaperone protein DnaJ 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ2 PE=3 SV=1 103 177 4.0E-12
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 103 167 4.0E-12
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 103 195 4.0E-12
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 103 167 4.0E-12
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 103 167 4.0E-12
sp|O74752|MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas5 PE=3 SV=1 100 167 4.0E-12
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 103 189 4.0E-12
sp|A6W2D1|DNAJ_MARMS Chaperone protein DnaJ OS=Marinomonas sp. (strain MWYL1) GN=dnaJ PE=3 SV=1 103 167 4.0E-12
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 103 190 4.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027080
MSSSYNILPSRPVYPHISTSCSHCNAALEFPVPSPQPRPGTLLQIRCFSCQNIISHAFYPNQVPSIASYNATTSS
DGGSKQQSQQQRKSRKIGTQDRPLETGYYDILGVPVTATTDDIKKAYRRLAIKHHPDKNPDDPLAEERFKEIAIA
YQTLSEPDLRKKYNEFGPKESAPEGGFVDPEEVFGAIFGGERFTSIIGDISLAREMKTALQEAEEAEEDARPKDA
KGREILSPEERAKKEEKERKKATEKAAARAKRVEQLVENLTRKVGIFAESATGPADADVSKSWRTICEIEAEELK
RESYGYELLQAIGFVYVSRAKQYLASNQTFLGVGGWLHNVQGKYHVFSETVSTLKAAIELKNVFDQIQAAEKAGN
LNDEEKRKLEEQAAEKGLQALFKGTKLEVESVLREVCDTILTDPTIPRDKAQLRAVALQMLGEAYMGVKKDAQSS
NPLVNGGAGEESEYVRIDTKSSRAREGNS*
Coding >AgabiH97|027080
ATGAGCTCTTCCTACAACATTCTACCTTCACGACCTGTATATCCTCATATCTCCACGTCATGCTCGCATTGTAAT
GCCGCTTTAGAATTTCCAGTGCCCAGCCCACAGCCACGACCAGGAACTCTCCTCCAAATTCGATGCTTTTCATGT
CAAAACATCATATCACATGCCTTTTATCCGAACCAGGTACCCTCAATAGCATCCTACAATGCTACAACATCGTCC
GATGGCGGCTCCAAACAACAGAGCCAACAACAGCGAAAGAGCAGGAAAATTGGCACACAGGATCGTCCGCTCGAG
ACTGGATATTATGATATTCTCGGTGTACCGGTGACAGCAACGACAGACGACATCAAGAAGGCGTACCGCCGGTTG
GCAATCAAACATCATCCTGATAAAAATCCTGATGATCCCCTCGCGGAGGAACGGTTCAAGGAGATTGCAATTGCT
TACCAGACACTATCGGAACCCGACCTACGAAAGAAATATAATGAGTTTGGCCCGAAGGAGAGCGCTCCTGAGGGA
GGATTCGTGGACCCGGAAGAAGTGTTCGGAGCTATTTTTGGAGGGGAAAGATTTACTTCAATCATTGGTGATATC
AGTCTGGCGAGAGAGATGAAGACAGCACTGCAAGAAGCCGAGGAAGCAGAAGAAGATGCGCGGCCGAAGGATGCT
AAAGGGAGGGAAATTCTGTCACCAGAGGAAAGGGCGAAGAAAGAAGAGAAGGAAAGAAAGAAGGCAACAGAGAAA
GCTGCGGCGCGTGCGAAACGAGTAGAGCAGCTCGTCGAGAACCTTACCCGTAAAGTTGGTATCTTTGCCGAATCG
GCCACTGGGCCAGCAGATGCAGATGTATCCAAGAGCTGGCGCACGATCTGCGAGATTGAAGCAGAGGAACTTAAA
CGCGAGTCATATGGCTACGAGCTACTGCAAGCCATTGGCTTTGTGTATGTCTCGAGAGCAAAACAATACCTTGCC
TCAAACCAGACTTTCCTTGGCGTTGGTGGCTGGCTCCACAACGTCCAAGGGAAATATCATGTTTTCAGCGAAACG
GTGTCAACATTGAAGGCAGCGATAGAACTCAAGAACGTTTTCGACCAAATCCAAGCTGCGGAGAAGGCTGGTAAT
CTCAATGACGAAGAAAAACGCAAGTTAGAAGAACAAGCCGCGGAGAAGGGACTTCAGGCCCTATTTAAAGGGACT
AAACTCGAAGTTGAATCCGTTTTACGTGAAGTATGTGATACCATCTTAACAGATCCTACAATACCGCGCGATAAA
GCCCAACTCCGCGCTGTTGCTTTGCAAATGCTTGGAGAAGCTTATATGGGTGTCAAGAAGGATGCTCAGAGCTCC
AATCCTTTGGTGAACGGTGGTGCTGGAGAAGAAAGCGAATATGTGAGGATTGATACGAAGAGCAGTCGAGCGAGG
GAGGGGAATTCATGA
Transcript >AgabiH97|027080
ATGAGCTCTTCCTACAACATTCTACCTTCACGACCTGTATATCCTCATATCTCCACGTCATGCTCGCATTGTAAT
GCCGCTTTAGAATTTCCAGTGCCCAGCCCACAGCCACGACCAGGAACTCTCCTCCAAATTCGATGCTTTTCATGT
CAAAACATCATATCACATGCCTTTTATCCGAACCAGGTACCCTCAATAGCATCCTACAATGCTACAACATCGTCC
GATGGCGGCTCCAAACAACAGAGCCAACAACAGCGAAAGAGCAGGAAAATTGGCACACAGGATCGTCCGCTCGAG
ACTGGATATTATGATATTCTCGGTGTACCGGTGACAGCAACGACAGACGACATCAAGAAGGCGTACCGCCGGTTG
GCAATCAAACATCATCCTGATAAAAATCCTGATGATCCCCTCGCGGAGGAACGGTTCAAGGAGATTGCAATTGCT
TACCAGACACTATCGGAACCCGACCTACGAAAGAAATATAATGAGTTTGGCCCGAAGGAGAGCGCTCCTGAGGGA
GGATTCGTGGACCCGGAAGAAGTGTTCGGAGCTATTTTTGGAGGGGAAAGATTTACTTCAATCATTGGTGATATC
AGTCTGGCGAGAGAGATGAAGACAGCACTGCAAGAAGCCGAGGAAGCAGAAGAAGATGCGCGGCCGAAGGATGCT
AAAGGGAGGGAAATTCTGTCACCAGAGGAAAGGGCGAAGAAAGAAGAGAAGGAAAGAAAGAAGGCAACAGAGAAA
GCTGCGGCGCGTGCGAAACGAGTAGAGCAGCTCGTCGAGAACCTTACCCGTAAAGTTGGTATCTTTGCCGAATCG
GCCACTGGGCCAGCAGATGCAGATGTATCCAAGAGCTGGCGCACGATCTGCGAGATTGAAGCAGAGGAACTTAAA
CGCGAGTCATATGGCTACGAGCTACTGCAAGCCATTGGCTTTGTGTATGTCTCGAGAGCAAAACAATACCTTGCC
TCAAACCAGACTTTCCTTGGCGTTGGTGGCTGGCTCCACAACGTCCAAGGGAAATATCATGTTTTCAGCGAAACG
GTGTCAACATTGAAGGCAGCGATAGAACTCAAGAACGTTTTCGACCAAATCCAAGCTGCGGAGAAGGCTGGTAAT
CTCAATGACGAAGAAAAACGCAAGTTAGAAGAACAAGCCGCGGAGAAGGGACTTCAGGCCCTATTTAAAGGGACT
AAACTCGAAGTTGAATCCGTTTTACGTGAAGTATGTGATACCATCTTAACAGATCCTACAATACCGCGCGATAAA
GCCCAACTCCGCGCTGTTGCTTTGCAAATGCTTGGAGAAGCTTATATGGGTGTCAAGAAGGATGCTCAGAGCTCC
AATCCTTTGGTGAACGGTGGTGCTGGAGAAGAAAGCGAATATGTGAGGATTGATACGAAGAGCAGTCGAGCGAGG
GAGGGGAATTCATGA
Gene >AgabiH97|027080
ATGAGCTCTTCCTACAACATTCTACCTTCACGACCTGTATATCCTCATATCTCCACGTCATGCTCGCATTGTAAT
GCCGCTTTAGAATTTCCAGTGCCCAGCCCACAGCCACGACCAGGAACTCTCCTCCAAATTCGATGCTTTTCATGT
CAAAACATCATATCACATGCCTTTTATCCGAACCAGGTACCCTCAATAGCATCCTACAATGCTACAACATCGTCC
GATGGCGGCTCCAAACAACAGAGCCAACAACAGCGAAAGAGCAGGAAAATTGGCACACAGGATCGTCCGCTCGAG
ACTGGATATTATGATATTCTCGGTGTACCGGTGACAGCAACGACAGACGACATCAAGAAGGCGTACCGTATGTAC
CTTTGTCGCAATTGTTATAATCAAGTCTAAAGAATGTCTCTTTCATTGTAGGCCGGTTGGCAATCAAACATCATC
CTGATAAAAATCCTGATGATCCCCTCGCGGAGGAACGGTTCAAGGAGATTGCAATTGCTTACCAGACACTATCGG
AACCCGACCTACGAAAGAAATATAATGAGTTTGGCCCGAAGGAGAGCGCTCCTGAGGGAGGATTCGTGGACCCGG
AAGAAGTGTTCGGAGCTATTTTTGGAGGGGAAAGATTTACTTCAATCATTGGTGATATCAGTCTGGCGAGAGAGA
TGAAGACAGCACTGCAAGAAGCCGAGGAAGCAGAAGAAGATGCGCGGCCGAAGGATGCTAAAGGGAGGGAAATTC
TGTCACCAGAGGAAAGGGCGAAGAAAGAAGAGAAGGAAAGAAAGAAGGCAACAGAGGTACGTTCACTAAGAGTTG
CCTCTCTCACTCCGAGGTCTGTACTCACTGTTGTTGTAGAAAGCTGCGGCGCGTGCGAAACGAGTAGAGCAGCTC
GTCGAGAACCTTACCCGTAAAGTTGGTATCTTTGCCGAATCGGCCACTGGGCCAGCAGATGCAGATGTATCCAAG
AGCTGGCGCACGATCTGCGAGATTGAAGCAGAGTACGCGCAATATCCACCTCTGATTTATATTCTATTCATTGTG
TTGCCATAGGGAACTTAAACGCGAGTCATATGGCTACGAGCTACTGCAAGCCATTGGCTTTGTGTATGTCTCGAG
AGCAAAACAATACCTTGCCTCAAACCAGACTTTCCTTGGCGTTGGTGGCTGGCTCCACAACGTCCAAGGGAAATA
TCATGTTTTCAGCGAAACGTGAGCTATATACCGGTTTATCCATGACATGCTTGTTGACGGCAAATTTTCTTTTTT
CTTTTCCTGCAAAGGGTGTCAACATTGAAGGCAGCGATAGAACTCAAGAACGTTTTCGACCAAATCCAAGCTGCG
GAGAAGGCTGGTAATCTCAATGACGAAGAAAAACGCAAGTTAGAAGAACAAGCCGCGGAGAAGGGACTTCAGGCC
CTATTTAAAGTACGCCTAACCTCCCGGTACTAAGAAGTTCATGAAATTTCTCATACGATTGTGACAGGGGACTAA
ACTCGAAGTTGAATCCGTTTTACGTGAAGTATGTGATACCATCTTAACAGATCCTACAATACCGCGCGATAAAGC
CCAACTCCGCGCTGTTGCTTTGCAAATGCTTGGAGAAGCTTATATGGGTGTCAAGAAGGATGCTCAGAGCTCCAA
TCCTTTGGTGAACGGTGGTGCTGGAGAAGAAAGCGAATATGTGAGGATTGATACGAAGAGCAGTCGAGCGAGGGA
GGGGAATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail