Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|027020
Gene name
Locationscaffold_11:1388993..1390546
Strand+
Gene length (bp)1553
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01435 Peptidase_M48 Peptidase family M48 4.3E-30 176 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G4|OMA1_SCHPO Mitochondrial metalloendopeptidase OMA1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oma1 PE=3 SV=1 66 344 7.0E-48
sp|P36163|OMA1_YEAST Mitochondrial metalloendopeptidase OMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OMA1 PE=1 SV=2 38 364 1.0E-40
sp|D3ZS74|OMA1_RAT Metalloendopeptidase OMA1, mitochondrial OS=Rattus norvegicus GN=Oma1 PE=3 SV=1 76 347 2.0E-19
sp|Q3SZN3|OMA1_BOVIN Metalloendopeptidase OMA1, mitochondrial OS=Bos taurus GN=OMA1 PE=2 SV=2 57 347 2.0E-19
sp|Q9D8H7|OMA1_MOUSE Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus GN=Oma1 PE=1 SV=1 26 347 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G4|OMA1_SCHPO Mitochondrial metalloendopeptidase OMA1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oma1 PE=3 SV=1 66 344 7.0E-48
sp|P36163|OMA1_YEAST Mitochondrial metalloendopeptidase OMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OMA1 PE=1 SV=2 38 364 1.0E-40
sp|D3ZS74|OMA1_RAT Metalloendopeptidase OMA1, mitochondrial OS=Rattus norvegicus GN=Oma1 PE=3 SV=1 76 347 2.0E-19
sp|Q3SZN3|OMA1_BOVIN Metalloendopeptidase OMA1, mitochondrial OS=Bos taurus GN=OMA1 PE=2 SV=2 57 347 2.0E-19
sp|Q9D8H7|OMA1_MOUSE Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus GN=Oma1 PE=1 SV=1 26 347 1.0E-18
sp|Q96E52|OMA1_HUMAN Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens GN=OMA1 PE=1 SV=1 57 347 5.0E-18
sp|E9QBI7|OMA1_DANRE Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio GN=oma1 PE=3 SV=1 56 349 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 243 265 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|027020
MPSWRVSSMFRPLLTASRLTYRIPKRELWTTIPKRNRYVRFSDGNAGRPSPNNQPGWRKFSPPVTYGAVIFAGIG
VFYVTHLEQVPQTGRWRFMIFSSRSEAQIGESVRQETKNEWGNKILPPNHPLSLHVRKVTSRILKSSDLGHIIGE
APTPPPISPFGFADEVWKPSDDYGAAASYTYSPQKEWDVVVVNDKRVVNAMATPGLILVFTGILPVCRDEQGLAA
VLSHEIGHVVARHSAERLSSGAFFMAISFFLQITGLDVIGFTPFINHFLLELPNSRTQEYEADLIGVRLMSRACY
DPAEMVQMFKRLEAATGSNRVDFLATHPSTGQRIKQLEETLPDAYSILASNPECAALRDKLEQFGNRTMPIRVND
FGEIEHV*
Coding >AgabiH97|027020
ATGCCGAGTTGGCGCGTCTCTTCCATGTTCAGACCACTTTTGACTGCCTCAAGACTTACTTATCGTATACCCAAA
AGAGAACTATGGACAACCATTCCGAAACGCAATCGTTATGTTCGCTTCTCTGACGGAAATGCCGGCCGACCTTCG
CCGAATAATCAGCCTGGGTGGCGCAAGTTCAGCCCACCAGTCACATACGGTGCTGTAATCTTTGCTGGTATAGGC
GTCTTCTATGTAACACATTTAGAACAGGTACCTCAGACTGGCCGGTGGCGCTTTATGATCTTCAGTAGTAGATCT
GAAGCTCAGATCGGCGAAAGTGTACGTCAGGAAACGAAAAACGAATGGGGTAATAAGATCCTACCCCCCAACCAT
CCATTATCCCTTCATGTGCGAAAGGTCACATCTCGCATTCTAAAGTCGTCCGACCTTGGTCATATTATAGGAGAA
GCTCCTACACCTCCGCCAATTTCCCCTTTCGGTTTCGCAGACGAAGTCTGGAAGCCGTCAGACGACTACGGCGCG
GCTGCAAGTTATACGTATAGTCCTCAGAAAGAATGGGATGTTGTAGTTGTAAATGATAAAAGAGTGGTCAACGCG
ATGGCTACACCTGGCTTGATTCTGGTATTTACTGGGATATTACCTGTATGTCGCGATGAGCAGGGACTCGCTGCT
GTTTTATCACATGAAATCGGTCATGTAGTTGCTCGCCATTCAGCCGAGCGTCTATCCTCAGGCGCATTCTTCATG
GCTATCTCATTCTTTTTACAGATCACTGGGCTTGATGTTATTGGTTTCACACCCTTCATCAATCATTTCCTCCTC
GAGCTCCCCAATTCCCGCACACAAGAATATGAAGCTGATCTCATCGGTGTTCGACTTATGTCTCGTGCTTGCTAT
GATCCTGCTGAGATGGTACAGATGTTTAAACGCCTCGAAGCGGCCACAGGATCCAACAGAGTAGACTTTCTAGCA
ACTCATCCATCAACTGGCCAACGCATCAAGCAACTTGAAGAAACGCTTCCGGATGCATATTCTATTCTTGCCTCA
AATCCGGAATGTGCAGCTTTAAGAGATAAATTAGAACAATTTGGGAATCGCACGATGCCAATTCGGGTTAATGAC
TTTGGAGAAATAGAACATGTGTAA
Transcript >AgabiH97|027020
ATGCCGAGTTGGCGCGTCTCTTCCATGTTCAGACCACTTTTGACTGCCTCAAGACTTACTTATCGTATACCCAAA
AGAGAACTATGGACAACCATTCCGAAACGCAATCGTTATGTTCGCTTCTCTGACGGAAATGCCGGCCGACCTTCG
CCGAATAATCAGCCTGGGTGGCGCAAGTTCAGCCCACCAGTCACATACGGTGCTGTAATCTTTGCTGGTATAGGC
GTCTTCTATGTAACACATTTAGAACAGGTACCTCAGACTGGCCGGTGGCGCTTTATGATCTTCAGTAGTAGATCT
GAAGCTCAGATCGGCGAAAGTGTACGTCAGGAAACGAAAAACGAATGGGGTAATAAGATCCTACCCCCCAACCAT
CCATTATCCCTTCATGTGCGAAAGGTCACATCTCGCATTCTAAAGTCGTCCGACCTTGGTCATATTATAGGAGAA
GCTCCTACACCTCCGCCAATTTCCCCTTTCGGTTTCGCAGACGAAGTCTGGAAGCCGTCAGACGACTACGGCGCG
GCTGCAAGTTATACGTATAGTCCTCAGAAAGAATGGGATGTTGTAGTTGTAAATGATAAAAGAGTGGTCAACGCG
ATGGCTACACCTGGCTTGATTCTGGTATTTACTGGGATATTACCTGTATGTCGCGATGAGCAGGGACTCGCTGCT
GTTTTATCACATGAAATCGGTCATGTAGTTGCTCGCCATTCAGCCGAGCGTCTATCCTCAGGCGCATTCTTCATG
GCTATCTCATTCTTTTTACAGATCACTGGGCTTGATGTTATTGGTTTCACACCCTTCATCAATCATTTCCTCCTC
GAGCTCCCCAATTCCCGCACACAAGAATATGAAGCTGATCTCATCGGTGTTCGACTTATGTCTCGTGCTTGCTAT
GATCCTGCTGAGATGGTACAGATGTTTAAACGCCTCGAAGCGGCCACAGGATCCAACAGAGTAGACTTTCTAGCA
ACTCATCCATCAACTGGCCAACGCATCAAGCAACTTGAAGAAACGCTTCCGGATGCATATTCTATTCTTGCCTCA
AATCCGGAATGTGCAGCTTTAAGAGATAAATTAGAACAATTTGGGAATCGCACGATGCCAATTCGGGTTAATGAC
TTTGGAGAAATAGAACATGTGTAA
Gene >AgabiH97|027020
ATGCCGAGTTGGCGCGTCTCTTCCATGTTCAGACCACTTTTGACTGCCTCAAGACTTACTTATCGTATACCCAAA
AGAGAACTATGGACAACCATTCCGAAACGCAATCGTTATGTTCGCTTCTCTGACGGAAATGCCGGCCGACCTTCG
CCGAATAATCAGCCTGGGTGGCGCAAGTTCAGCCCACCAGTCACATACGGTGCTGTAATCTTTGCTGGTATAGGC
GTCTTCTATGTAACACAGTGCGCTTTTTTTTGCTGCTCGAGTTGAAAGCTTCTCTCAATTTACAAAGTTTAGAAC
AGGTACCTCAGACTGGCCGGTGGCGCTTTATGATCTTCAGTAGTAGATCTGAAGCTCAGGTATACAGCTCTTCTT
CTTCATTCGCAAGCAACCTTAACGTGTAGTTTAGATCGGCGAAAGTGTACGTCAGGAAACGAAAAACGAATGGGG
TAATAAGATCCTACCCCCCAACCATCCATTATCCCTTCATGTGCGAAAGGTCACATCTCGCATTCTAAAGTCGTC
CGACCTTGGTCATATTATAGGAGAAGCTCCTACACCTCCGCCAATTTCCCCTTTCGGTTTCGCAGACGAAGTCTG
GAAGCCGTCAGACGACTACGGCGCGGCTGCAAGTTATACGTATAGTCCTCAGAAAGAATGGGATGTTGTAGTTGT
AAATGATAAAAGAGTGGTCAACGCGATGGCTACACCTGGTAGGTTGCATCATAAGGTCCTTGTGATTATCGGGAA
CTTACCGCTTTCTAGGCTTGATTCTGGTATTTACTGGGATATTACCTGTATGTCGCGATGAGCAGGGACTCGCTG
CTGTTTTATCACATGGTCCGCTCTCCTCCTAGACCACTTGATGCCCACCTCTCTTATCATCTTGTCCAGAAATCG
GTCATGTAGTTGCTCGCCATTCAGCCGAGCGTCTATCCTCAGGCGCATTCTTCATGGCTATCTCATTCTTTTTAC
AGATCACTGGGCTTGATGTTATTGGTTTCACACCCTTCATCAATCATTTCCTCCTCGAGCTCCCCAATTCCCGCA
CACAAGAATATGAAGGTAATATTGATCCTTTTCAATCACCTTTTCGTAATGTTAATACATCGTTGACATTTCGTT
TAGCTGATCTCATCGGTGTTCGACTTATGTCTCGTGCTTGCTATGATCCTGCTGAGATGGTACAGTACGTTACTT
TTCCATCATGGCCAACGGATCAATCATTAACTCATATTACTCGCCTTCAAATTAACAGGATGTTTAAACGCCTCG
AAGCGGCCACAGGATCCAACAGAGTAGACTTTCTAGCAACTCATCCATCAACTGGCCAACGCATCAAGGTTAGAC
AACTGAACTCCATGAAAGTCTCAAAAGAGTCCTCACTCATTCTTTTTCTTTCATTATAGCAACTTGAAGAAACGC
TTCCGGATGCATATTCTATTCTTGCCTCAAATCCGGAATGTGCAGCTTTAAGAGATAAATTAGAACAATTTGGGA
ATCGCACGATGCCAATTCGGGTTAATGACTTTGGAGAAATAGAACATGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail