Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026870
Gene name
Locationscaffold_11:1355207..1356159
Strand+
Gene length (bp)952
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 2.3E-08 77 233

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 12 234 1.0E-07
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 30 234 5.0E-07

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026870
MALPHVHSLQRAEVDAGYCSIETVSVPSDGHIRNEDRVTWLFTWYGVIIAVFDGHYGQTASEYAKSHLLNHIHER
VSHDISRNNFENVESTLRTAIIDFDASLMKAILQKLQEFSSSKSLPLSDWSMERDTQDFLGMKENGENDPYPVNR
RAAEGTTVLLSLLVKQDSGYEAWTVSLGDSDGFIIDQNHTSTIISEQHGAQNPKEVDPLIEEHPDDPDAVLHSRV
KGQLAVTRGKYTLALSLSSNLPTYLPPSFRGRYLEGRQTIRACSFLSMGNAYSLDNGR*
Coding >AgabiH97|026870
ATGGCCTTACCGCATGTCCATAGCCTTCAGCGAGCGGAAGTCGATGCTGGGTATTGCTCGATCGAGACTGTATCG
GTACCGTCTGACGGCCACATACGCAACGAAGACAGGGTAACTTGGCTTTTCACCTGGTATGGCGTGATTATAGCG
GTATTTGACGGGCACTATGGTCAAACAGCTTCGGAGTATGCCAAGAGTCACTTGCTGAATCACATTCACGAGCGC
GTTTCGCACGACATCTCCCGCAACAATTTTGAAAACGTGGAGTCTACGCTTAGGACTGCCATTATAGATTTCGAT
GCATCGCTTATGAAAGCAATTCTTCAAAAACTACAAGAGTTCTCTTCCAGCAAGTCTCTGCCTCTTTCAGACTGG
TCAATGGAACGAGATACTCAGGATTTCCTGGGTATGAAGGAAAATGGAGAGAATGATCCGTACCCTGTAAATCGA
AGGGCTGCGGAAGGTACCACCGTTCTGCTCTCTCTTCTCGTCAAACAAGATTCTGGTTATGAAGCCTGGACTGTT
TCTCTTGGTGATTCAGATGGCTTTATAATCGATCAAAACCATACTTCAACCATTATCAGCGAGCAACACGGCGCC
CAGAATCCGAAAGAAGTGGACCCTCTTATTGAAGAACATCCAGATGACCCTGACGCTGTTTTGCATTCCCGTGTC
AAAGGACAGTTGGCAGTTACCAGAGGCAAGTACACCTTGGCACTTTCATTGTCGAGTAATCTTCCGACGTATCTT
CCCCCTAGCTTTAGGGGACGCTATCTTGAAGGTCGACAAACCATACGCGCATGCTCTTTCTTGTCTATGGGGAAT
GCCTATTCATTGGACAACGGTCGATAA
Transcript >AgabiH97|026870
ATGGCCTTACCGCATGTCCATAGCCTTCAGCGAGCGGAAGTCGATGCTGGGTATTGCTCGATCGAGACTGTATCG
GTACCGTCTGACGGCCACATACGCAACGAAGACAGGGTAACTTGGCTTTTCACCTGGTATGGCGTGATTATAGCG
GTATTTGACGGGCACTATGGTCAAACAGCTTCGGAGTATGCCAAGAGTCACTTGCTGAATCACATTCACGAGCGC
GTTTCGCACGACATCTCCCGCAACAATTTTGAAAACGTGGAGTCTACGCTTAGGACTGCCATTATAGATTTCGAT
GCATCGCTTATGAAAGCAATTCTTCAAAAACTACAAGAGTTCTCTTCCAGCAAGTCTCTGCCTCTTTCAGACTGG
TCAATGGAACGAGATACTCAGGATTTCCTGGGTATGAAGGAAAATGGAGAGAATGATCCGTACCCTGTAAATCGA
AGGGCTGCGGAAGGTACCACCGTTCTGCTCTCTCTTCTCGTCAAACAAGATTCTGGTTATGAAGCCTGGACTGTT
TCTCTTGGTGATTCAGATGGCTTTATAATCGATCAAAACCATACTTCAACCATTATCAGCGAGCAACACGGCGCC
CAGAATCCGAAAGAAGTGGACCCTCTTATTGAAGAACATCCAGATGACCCTGACGCTGTTTTGCATTCCCGTGTC
AAAGGACAGTTGGCAGTTACCAGAGGCAAGTACACCTTGGCACTTTCATTGTCGAGTAATCTTCCGACGTATCTT
CCCCCTAGCTTTAGGGGACGCTATCTTGAAGGTCGACAAACCATACGCGCATGCTCTTTCTTGTCTATGGGGAAT
GCCTATTCATTGGACAACGGTCGATAA
Gene >AgabiH97|026870
ATGGCCTTACCGCATGTCCATAGCCTTCAGCGAGCGGAAGTCGATGCTGGGTATTGCTCGATCGAGACTGTATCG
GTACCGTCTGACGGCCACATACGCAACGAAGACAGGGTAACTTGGCTTTTCACCTGGTATGGCGTGATTATAGCG
GTATTTGACGGTTCGTGTGGGGTTCGGACGATTGCTTTTCATGTTATTCAGAATCTTTCAGGGCACTATGGTCAA
ACAGCTTCGGAGTATGCCAAGAGTCACTTGCTGAATCACATTCACGAGCGCGTTTCGCACGACATCTCCCGCAAC
AATTTTGAAAACGTGGAGTCTACGCTTAGGACTGCCATTATAGATTTCGATGCATCGCTTATGAAAGCAATTCTT
CAAAAACTACAAGAGTTCTCTTCCAGCAAGTCTCTGCCTCTTTCAGACTGGTCAATGGAACGAGATACTCAGGAT
TTCCTGGGTATGAAGGAAAATGGAGAGAATGATCCGTACCCTGTAAATCGAAGGGCTGCGGAAGGTACCACCGTT
CTGCTCTCTCTTCTCGTCAAACAAGATTCTGGTTATGAAGCCTGGACTGTTTCTCTTGGTGATTCAGATGGCTGT
GAGTTGTTGAATATGCGCGATTAATATTAACAAATATTGTCGCCTAGTTATAATCGATCAAAACCATACTTCAAC
CATTATCAGCGAGCAACACGGCGCCCAGAATCCGAAAGAAGTGGACCCTCTTATTGAAGAACATCCAGATGACCC
TGACGCTGTTTTGCATTCCCGTGTCAAAGGACAGTTGGCAGTTACCAGAGGCAAGTACACCTTGGCACTTTCATT
GTCGAGTAATCTTCCGACGTATCTTCCCCCTAGCTTTAGGGGACGCTATCTTGAAGGTCGACAAACCATACGCGC
ATGCTCTTTCTTGTCTATGGGGAATGCCTATTCATTGGACAACGGTCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail