Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026860
Gene name
Locationscaffold_11:1351271..1352500
Strand-
Gene length (bp)1229
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 3.7E-16 49 298
PF13672 PP2C_2 Protein phosphatase 2C 1.4E-05 31 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 155 353 1.0E-12
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 133 307 9.0E-12
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 48 337 2.0E-11
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 178 302 6.0E-08
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 198 298 9.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 155 353 1.0E-12
sp|Q7XVF9|P2C39_ORYSJ Probable protein phosphatase 2C 39 OS=Oryza sativa subsp. japonica GN=Os04g0403701 PE=2 SV=2 133 307 9.0E-12
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 48 337 2.0E-11
sp|Q9ZV25|P2C23_ARATH Probable protein phosphatase 2C 23 OS=Arabidopsis thaliana GN=PLL4 PE=2 SV=1 178 302 6.0E-08
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 198 298 9.0E-08
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 194 298 2.0E-07
sp|Q8RWN7|P2C32_ARATH Protein phosphatase 2C 32 OS=Arabidopsis thaliana GN=POL PE=1 SV=2 191 307 2.0E-07
sp|Q84T94|P2C35_ORYSJ Protein phosphatase 2C 35 OS=Oryza sativa subsp. japonica GN=XB15 PE=1 SV=1 190 302 2.0E-07
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 97 298 2.0E-07
sp|Q10NB9|P2C31_ORYSJ Probable protein phosphatase 2C 31 OS=Oryza sativa subsp. japonica GN=Os03g0275100 PE=2 SV=1 186 302 3.0E-07
sp|Q6ZGY0|P2C26_ORYSJ Probable protein phosphatase 2C 26 OS=Oryza sativa subsp. japonica GN=Os02g0690500 PE=2 SV=1 194 352 3.0E-07
sp|Q9SR24|P2C36_ARATH Probable protein phosphatase 2C 36 OS=Arabidopsis thaliana GN=PLL3 PE=2 SV=1 194 302 6.0E-07
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 173 298 1.0E-06
sp|O82302|P2C29_ARATH Protein phosphatase 2C 29 OS=Arabidopsis thaliana GN=PLL1 PE=1 SV=2 191 298 2.0E-06
sp|Q9LZ86|P2C66_ARATH Probable protein phosphatase 2C 66 OS=Arabidopsis thaliana GN=PLL2 PE=2 SV=1 197 302 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026860
MVTEHIHSLQRAEVDAGYCSIETVSVPSDSHECNEDRVTWLFTWYGVILAVFDGHYGPVTSEYAKNHLLNLVHER
VSHDITRKNLDNVESTLRAAIIDFDAALIGNILQRLDDFSSTESRPFSNWTMDDDTPEFLGMKENGENDPYAVNR
RAAEGTTVLLSLLVKQDSGYEAWTASLGDSDGFTIDRNHTATIVSEQHGAQNPKEVDRLVKEHPGDPDTILYSRV
KGQLAITRALGNAILKVDKLYARVLSRMWGTPVHWTTVDGWTNHSPPYILSNPDIKRHQVRETDLLVFASDGLRA
AFRTSSIELGNVISRIAGESSNPGLASRIMDEARRCAQGKLVDDVTILVFRVGKV*
Coding >AgabiH97|026860
ATGGTCACGGAACATATCCATAGCCTTCAGCGAGCGGAAGTTGATGCTGGATATTGCTCAATCGAGACTGTATCG
GTACCATCTGACAGCCACGAATGTAACGAAGATAGGGTAACTTGGCTTTTCACCTGGTATGGTGTAATCTTAGCG
GTTTTTGACGGGCACTATGGTCCCGTTACTTCGGAGTATGCCAAGAATCACTTGCTGAATCTCGTCCACGAGCGC
GTTTCGCATGACATCACCCGTAAAAACCTCGACAACGTAGAATCTACGCTCAGGGCTGCCATTATAGATTTCGAT
GCTGCGCTCATAGGAAATATCCTTCAAAGACTGGACGATTTCTCTTCCACTGAGTCTCGACCTTTTTCGAATTGG
ACAATGGATGATGATACTCCGGAATTCCTTGGTATGAAAGAAAATGGAGAAAATGATCCATATGCTGTAAACCGA
AGGGCTGCGGAAGGTACCACCGTTCTTCTCTCTCTTCTCGTCAAACAAGATTCGGGCTATGAAGCTTGGACTGCT
TCTCTTGGTGACTCAGATGGCTTTACAATCGATCGAAACCATACCGCAACCATTGTCAGCGAGCAGCACGGCGCC
CAGAATCCGAAAGAAGTGGATCGTCTTGTGAAGGAACATCCGGGTGATCCTGACACGATCTTATATTCACGCGTT
AAAGGACAGCTGGCGATCACCAGAGCTTTGGGGAATGCTATCTTGAAGGTCGACAAATTATACGCACGTGTTCTT
TCTCGTATGTGGGGCACACCAGTTCACTGGACAACGGTCGATGGTTGGACAAACCACTCCCCTCCCTACATTCTC
TCTAATCCAGATATCAAACGACACCAAGTACGCGAGACGGACCTTCTTGTATTTGCTTCCGATGGCCTTCGCGCG
GCATTTAGAACGTCTTCTATCGAATTAGGAAATGTTATATCTCGCATTGCCGGTGAATCTAGCAATCCAGGGCTA
GCGTCAAGAATCATGGATGAAGCACGCCGTTGTGCGCAAGGCAAGCTGGTGGATGATGTTACTATCTTGGTTTTT
CGAGTGGGGAAAGTGTAA
Transcript >AgabiH97|026860
ATGGTCACGGAACATATCCATAGCCTTCAGCGAGCGGAAGTTGATGCTGGATATTGCTCAATCGAGACTGTATCG
GTACCATCTGACAGCCACGAATGTAACGAAGATAGGGTAACTTGGCTTTTCACCTGGTATGGTGTAATCTTAGCG
GTTTTTGACGGGCACTATGGTCCCGTTACTTCGGAGTATGCCAAGAATCACTTGCTGAATCTCGTCCACGAGCGC
GTTTCGCATGACATCACCCGTAAAAACCTCGACAACGTAGAATCTACGCTCAGGGCTGCCATTATAGATTTCGAT
GCTGCGCTCATAGGAAATATCCTTCAAAGACTGGACGATTTCTCTTCCACTGAGTCTCGACCTTTTTCGAATTGG
ACAATGGATGATGATACTCCGGAATTCCTTGGTATGAAAGAAAATGGAGAAAATGATCCATATGCTGTAAACCGA
AGGGCTGCGGAAGGTACCACCGTTCTTCTCTCTCTTCTCGTCAAACAAGATTCGGGCTATGAAGCTTGGACTGCT
TCTCTTGGTGACTCAGATGGCTTTACAATCGATCGAAACCATACCGCAACCATTGTCAGCGAGCAGCACGGCGCC
CAGAATCCGAAAGAAGTGGATCGTCTTGTGAAGGAACATCCGGGTGATCCTGACACGATCTTATATTCACGCGTT
AAAGGACAGCTGGCGATCACCAGAGCTTTGGGGAATGCTATCTTGAAGGTCGACAAATTATACGCACGTGTTCTT
TCTCGTATGTGGGGCACACCAGTTCACTGGACAACGGTCGATGGTTGGACAAACCACTCCCCTCCCTACATTCTC
TCTAATCCAGATATCAAACGACACCAAGTACGCGAGACGGACCTTCTTGTATTTGCTTCCGATGGCCTTCGCGCG
GCATTTAGAACGTCTTCTATCGAATTAGGAAATGTTATATCTCGCATTGCCGGTGAATCTAGCAATCCAGGGCTA
GCGTCAAGAATCATGGATGAAGCACGCCGTTGTGCGCAAGGCAAGCTGGTGGATGATGTTACTATCTTGGTTTTT
CGAGTGGGGAAAGTGTAA
Gene >AgabiH97|026860
ATGGTCACGGAACATATCCATAGCCTTCAGCGAGCGGAAGTTGATGCTGGATATTGCTCAATCGAGACTGTATCG
GTACCATCTGACAGCCACGAATGTAACGAAGATAGGGTAACTTGGCTTTTCACCTGGTATGGTGTAATCTTAGCG
GTTTTTGACGGTTCGTATGAGTTTGAATAATTGCATTTCACATTATTAAGATTTTGTCAGGGCACTATGGTCCCG
TTACTTCGGAGTATGCCAAGAATCACTTGCTGAATCTCGTCCACGAGCGCGTTTCGCATGACATCACCCGTAAAA
ACCTCGACAACGTAGAATCTACGCTCAGGGCTGCCATTATAGATTTCGATGCTGCGCTCATAGGAAATATCCTTC
AAAGACTGGACGATTTCTCTTCCACTGAGTCTCGACCTTTTTCGAATTGGACAATGGATGATGATACTCCGGAAT
TCCTTGGTATGAAAGAAAATGGAGAAAATGATCCATATGCTGTAAACCGAAGGGCTGCGGAAGGTACCACCGTTC
TTCTCTCTCTTCTCGTCAAACAAGATTCGGGCTATGAAGCTTGGACTGCTTCTCTTGGTGACTCAGATGGCTGTG
AGTTGTTCAATATGCTCAATTAAGTCTGACCAAATATCATCACTTAGTTACAATCGATCGAAACCATACCGCAAC
CATTGTCAGCGAGCAGCACGGCGCCCAGAATCCGAAAGAAGTGGATCGTCTTGTGAAGGAACATCCGGGTGATCC
TGACACGATCTTATATTCACGCGTTAAAGGACAGCTGGCGATCACCAGAGGCAAGTACACCTTGGCCCATTCATC
GACGATTAATCTTACAACGCGACATCTTCCCATCAGCTTTGGGGAATGCTATCTTGAAGGTCGACAAATTATACG
CACGTGTTCTTTCTCGTATGTGGGGCACACCAGTTCACTGGACAACGGTCGATGGTTGGACAAACCACTCCCCTC
CCTACATTCTCTCTAATCCAGATATCAAACGACACCAAGTACGCGAGACGGACCTTCTTGTATTTGCTTCCGATG
GCCTTCGCGCGGCATTTAGAACGTCTTCTATCGAATTAGGAAATGTTATATCTCGCATTGCCGGTGAATCTAGCA
ATCCAGGGCTAGCGTCAAGAATCATGGATGAAGCACGCCGTTGTGCGCAAGGCAAGCTGGTGGATGATGTTACTA
TCTTGGTTTTTCGAGTGGGGAAAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail