Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026830
Gene name
Locationscaffold_11:1346195..1347451
Strand-
Gene length (bp)1256
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-09 106 205
PF00071 Ras Ras family 1.4E-04 107 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JXL4|MNME_NEIMB tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup B (strain MC58) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|A1KW66|MNME_NEIMF tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|A9M0N5|MNME_NEIM0 tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C (strain 053442) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|Q9JWB7|MNME_NEIMA tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|B4RRB9|MNME_NEIG2 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mnmE PE=3 SV=1 106 165 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JXL4|MNME_NEIMB tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup B (strain MC58) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|A1KW66|MNME_NEIMF tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|A9M0N5|MNME_NEIM0 tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C (strain 053442) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|Q9JWB7|MNME_NEIMA tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mnmE PE=3 SV=1 106 165 1.0E-07
sp|B4RRB9|MNME_NEIG2 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mnmE PE=3 SV=1 106 165 2.0E-07
sp|Q5F529|MNME_NEIG1 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mnmE PE=3 SV=1 106 165 2.0E-07
sp|Q2KTI2|MNME_BORA1 tRNA modification GTPase MnmE OS=Bordetella avium (strain 197N) GN=mnmE PE=3 SV=1 106 165 2.0E-07
sp|C1D6H7|MNME_LARHH tRNA modification GTPase MnmE OS=Laribacter hongkongensis (strain HLHK9) GN=mnmE PE=3 SV=1 87 165 6.0E-07
sp|Q7NPT9|MNME_CHRVO tRNA modification GTPase MnmE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mnmE PE=3 SV=1 88 165 7.0E-07
sp|Q31DJ0|MNME_THICR tRNA modification GTPase MnmE OS=Thiomicrospira crunogena (strain XCL-2) GN=mnmE PE=3 SV=2 85 167 1.0E-06
sp|A1KCP8|MNME_AZOSB tRNA modification GTPase MnmE OS=Azoarcus sp. (strain BH72) GN=mnmE PE=3 SV=1 79 165 2.0E-06
sp|Q7W2J0|MNME_BORPA tRNA modification GTPase MnmE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mnmE PE=3 SV=1 106 165 4.0E-06
sp|Q7VSR5|MNME_BORPE tRNA modification GTPase MnmE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mnmE PE=3 SV=1 106 165 5.0E-06
sp|A9IJ97|MNME_BORPD tRNA modification GTPase MnmE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=mnmE PE=3 SV=1 106 167 5.0E-06
sp|Q7WDI4|MNME_BORBR tRNA modification GTPase MnmE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mnmE PE=3 SV=1 106 167 5.0E-06
sp|Q5P4P5|MNME_AROAE tRNA modification GTPase MnmE OS=Aromatoleum aromaticum (strain EbN1) GN=mnmE PE=3 SV=1 80 165 5.0E-06
sp|A4GAN2|MNME_HERAR tRNA modification GTPase MnmE OS=Herminiimonas arsenicoxydans GN=mnmE PE=3 SV=1 78 166 5.0E-06
sp|Q82XA1|MNME_NITEU tRNA modification GTPase MnmE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mnmE PE=3 SV=1 106 165 8.0E-06
sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase MnmE OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mnmE PE=3 SV=1 107 163 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026830
MSAFNSRQGRGSTNTPPGQESGYSAATYGPSVKGARIASNRTRDTTNHYQQTPEQHQWTAQGPQASNLSPVHVPA
AHNPRFYPSRSFASATRARLFRKSQLNGPGNIVIFGETGTGKSSLVNMLSDDNVAMVSNLATGCTFESTPHAVFI
DGVPYTLWDTAGLNEGNTGSVPADQALHYLRDLVDKLKDGVSLLVYCIRGSRYRDIIKVNYDLFTEIICQGEVPV
VIVVTGLENEERMEGWWEENAKEFTDRGMLFQSHACVTTSKGKKNMFEAEYEESKHTVRNLIKDFCPGSAWTVDS
DQWFGRITNRIQEYWEEYNGCQHHTSRPEREGEGEEISSLFAVIGLFLLSLVQNFSPFRSPNY*
Coding >AgabiH97|026830
ATGTCAGCCTTCAATTCTCGTCAAGGCCGGGGGTCTACCAATACGCCGCCAGGTCAGGAGAGCGGTTATTCTGCC
GCTACATACGGACCTTCTGTGAAAGGTGCACGGATTGCGAGCAATCGTACTCGCGATACCACGAACCATTATCAG
CAAACGCCAGAGCAACATCAATGGACTGCGCAAGGTCCCCAAGCTTCGAATCTTTCTCCTGTTCATGTACCAGCT
GCTCATAACCCACGCTTCTACCCCAGTAGATCTTTCGCATCTGCTACACGAGCACGTCTATTTCGCAAAAGCCAA
CTCAATGGACCAGGCAATATTGTAATATTTGGGGAGACGGGCACCGGAAAGAGCAGCCTGGTCAACATGCTTTCC
GACGACAATGTTGCTATGGTTAGCAACCTTGCTACTGGTTGCACGTTTGAAAGCACCCCTCATGCCGTGTTTATC
GATGGAGTTCCCTACACCTTGTGGGATACTGCGGGCCTGAACGAAGGTAACACGGGTTCCGTACCGGCTGATCAA
GCTCTTCACTATCTTCGCGACCTGGTTGACAAGCTGAAAGACGGTGTCAGTCTTCTTGTATACTGTATTCGCGGT
TCAAGATATCGAGATATTATAAAAGTCAACTACGACCTTTTCACGGAGATCATCTGCCAGGGTGAGGTCCCCGTC
GTGATTGTCGTGACTGGATTGGAAAACGAAGAGCGCATGGAGGGTTGGTGGGAGGAGAATGCGAAGGAGTTCACT
GACCGCGGGATGCTCTTCCAAAGTCATGCTTGCGTCACTACATCGAAGGGGAAGAAAAACATGTTCGAGGCGGAG
TATGAGGAATCGAAGCATACTGTTCGGAACTTGATCAAGGATTTTTGTCCAGGAAGCGCATGGACGGTGGACTCT
GACCAGTGGTTTGGACGTATTACCAATCGTATTCAGGAGTATTGGGAAGAGTATAATGGTTGCCAGCACCACACT
TCTAGGCCAGAGAGGGAGGGAGAAGGGGAAGAAATATCGAGCCTATTCGCAGTCATTGGATTATTCTTGCTTTCT
CTAGTGCAAAATTTTTCTCCATTTCGTTCGCCAAACTACTAG
Transcript >AgabiH97|026830
ATGTCAGCCTTCAATTCTCGTCAAGGCCGGGGGTCTACCAATACGCCGCCAGGTCAGGAGAGCGGTTATTCTGCC
GCTACATACGGACCTTCTGTGAAAGGTGCACGGATTGCGAGCAATCGTACTCGCGATACCACGAACCATTATCAG
CAAACGCCAGAGCAACATCAATGGACTGCGCAAGGTCCCCAAGCTTCGAATCTTTCTCCTGTTCATGTACCAGCT
GCTCATAACCCACGCTTCTACCCCAGTAGATCTTTCGCATCTGCTACACGAGCACGTCTATTTCGCAAAAGCCAA
CTCAATGGACCAGGCAATATTGTAATATTTGGGGAGACGGGCACCGGAAAGAGCAGCCTGGTCAACATGCTTTCC
GACGACAATGTTGCTATGGTTAGCAACCTTGCTACTGGTTGCACGTTTGAAAGCACCCCTCATGCCGTGTTTATC
GATGGAGTTCCCTACACCTTGTGGGATACTGCGGGCCTGAACGAAGGTAACACGGGTTCCGTACCGGCTGATCAA
GCTCTTCACTATCTTCGCGACCTGGTTGACAAGCTGAAAGACGGTGTCAGTCTTCTTGTATACTGTATTCGCGGT
TCAAGATATCGAGATATTATAAAAGTCAACTACGACCTTTTCACGGAGATCATCTGCCAGGGTGAGGTCCCCGTC
GTGATTGTCGTGACTGGATTGGAAAACGAAGAGCGCATGGAGGGTTGGTGGGAGGAGAATGCGAAGGAGTTCACT
GACCGCGGGATGCTCTTCCAAAGTCATGCTTGCGTCACTACATCGAAGGGGAAGAAAAACATGTTCGAGGCGGAG
TATGAGGAATCGAAGCATACTGTTCGGAACTTGATCAAGGATTTTTGTCCAGGAAGCGCATGGACGGTGGACTCT
GACCAGTGGTTTGGACGTATTACCAATCGTATTCAGGAGTATTGGGAAGAGTATAATGGTTGCCAGCACCACACT
TCTAGGCCAGAGAGGGAGGGAGAAGGGGAAGAAATATCGAGCCTATTCGCAGTCATTGGATTATTCTTGCTTTCT
CTAGTGCAAAATTTTTCTCCATTTCGTTCGCCAAACTACTAG
Gene >AgabiH97|026830
ATGTCAGCCTTCAATTCTCGTCAAGGCCGGGGGTCTACCAATAGTAAGTGATTGGACAATTGAATCGATGTGGCA
TGAATAAACGAGTATCAAGCGCCGCCAGGTCAGGAGAGCGGTTATTCTGCCGCTACATACGGACCTTCTGTGAAA
GGTGCACGGATTGCGAGCAATCGTACTCGCGATACCACGAACCATTATCAGCAAACGCCAGAGCAACATCAATGG
ACTGCGCAAGGTCCCCAAGCTTCGAGTATGCCGTTATATTTCATAGACTTGGGCGCCCATCTTACCTATTGTCAG
ATCTTTCTCCTGTTCATGTACCAGGTAACTCCCATGTTTAAAGTACGCGGTCCTCAGGTGTCCTGAATCTGATAT
GTCTCTTATCAGCTGCTCATAACCCACGCTTCTACCCCAGTAGATCTTTCGCATCTGCTACACGAGCACGTCTAT
TTCGCAAAAGCCAACTCAATGGACCAGGCAATATTGTAATATTTGGGGAGACGGGCACCGGAAAGAGCAGCCTGG
TCAACATGCTTTCCGACGACAATGTTGCTATGGTTAGCAACCTTGCTACTGGTTGCACGTTTGAAAGCACCCCTC
ATGCCGTGTTTATCGATGGAGTTCCCTACACCTTGTGGGATACTGCGGGCCTGAACGAAGGTAACACGGGTTCCG
TACCGGCTGATCAAGCTCTTCACTATCTTCGCGACCTGGTTGACAAGCTGAAAGACGGTGTCAGTCTTCTTGTAT
ACTGTATTCGCGGTTCAAGATATCGAGATATTATAAAAGTCAACTACGACCTTTTCACGGAGATCATCTGCCAGG
GTGAGGTCCCCGTCGTGATTGTCGTGACTGGATTGGAAAACGAAGAGCGCATGGAGGGTTGGTGGGAGGAGAATG
CGAAGGAGTTCACTGACCGCGGGATGCTCTTCCAAAGTCATGCTTGCGTCACTACATCGAAGGGGAAGAAAAACA
TGTTCGAGGCGGAGTATGAGGAATCGAAGCATACTGTTCGGAACTTGATCAAGGATTTTTGTCCAGGAAGCGCAT
GGACGGTGGACTCTGACCAGTGGTTTGGACGTATTACCAATCGTATTCAGGAGTATTGGGAAGAGTATAATGGTT
GCCAGCACCACACTTCTAGGCCAGAGAGGGAGGGAGAAGGGGAAGAAATATCGAGCCTATTCGCAGTCATTGGAT
TATTCTTGCTTTCTCTAGTGCAAAATTTTTCTCCATTTCGTTCGCCAAACTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail