Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026670
Gene name
Locationscaffold_11:1304096..1305823
Strand-
Gene length (bp)1727
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 9.8E-36 80 474

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P37906|PUUB_ECOLI Gamma-glutamylputrescine oxidoreductase OS=Escherichia coli (strain K12) GN=puuB PE=1 SV=2 79 487 3.0E-10
sp|Q9Z3S3|ORDL_RHIME Probable oxidoreductase OrdL OS=Rhizobium meliloti (strain 1021) GN=ordL PE=4 SV=2 75 482 2.0E-08
sp|P44732|ORDL_HAEIN Probable oxidoreductase OrdL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ordL PE=4 SV=1 77 480 6.0E-07

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026670
MPKHSRLFTYSFLFLTLSSSKSQLLNQQAPWSLSNYSRPPWLTLPVTNPTKSFWIDKPGVNPLAREGSTGTLGFG
DEDVDVCVIGSGITGISAVYHLQRLLDAQGIDKKVVVLEAREFCSGATGRNGGHLTRNFFHDFGSRESHYGTENA
KKSYLIEEHVAKSIVNTIHSHGLVDAVDLVQGDHITLFFEDEEAQLALRDYKDAQANGLDLKGVEFLDRGAMMER
YGVNYPGVFFPSHNLWPLKLVTFLYNSSLSRSSSKVKLHTLTPVTSVLPSTLEGHTFPQRESKWTVETPRGSLNC
NNIIHATNAYASYLLPQYQDQIIPTRGQMTALRAKSSLDRLLHHSWGANWGYEYWFPRPEEISDSVETRNPPLVL
LGGGRDTAGPKQEQYTMDDSVISEKVSKTLNRFLPELWNGTDLFEEGREPEMEWTGIMGFTSNGEPIVGPIPELD
GQYIAAGFTGHGMPRAFAAAEAVAGMIVAKLTNKEWEAPEWLPEHYLTSWNL*
Coding >AgabiH97|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAAATCCCAACTTCTG
AATCAGCAGGCCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGCTCCGGTGCTACTGGGAGG
AACGGTGGGCATCTCACAAGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCG
AAGAAAAGCTATCTTATTGAGGAACATGTGGCGAAGTCGATTGTGAACACTATCCATTCACATGGTTTGGTCGAT
GCGGTCGACCTCGTCCAGGGGGATCATATTACACTATTCTTCGAGGACGAGGAGGCTCAGCTGGCTTTGCGAGAT
TACAAAGATGCACAAGCAAATGGACTAGACTTGAAAGGTGTGGAGTTTCTTGACAGAGGCGCAATGATGGAGAGA
TATGGGGTCAACTATCCTGGCGTTTTTTTTCCCTCCCATAATCTTTGGCCTCTGAAACTTGTTACGTTTCTATAC
AACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTACATACTCTCACTCCTGTCACATCTGTTCTTCCGTCT
ACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAATGGACCGTAGAAACACCTCGAGGCTCATTGAATTGC
AATAACATAATCCACGCTACAAATGCCTACGCCTCTTACCTTCTACCTCAATATCAGGACCAAATAATACCTACC
CGTGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTAGACCGTCTGCTACATCATTCCTGGGGAGCAAATTGG
GGATACGAGTACTGGTTTCCGAGGCCAGAGGAAATTTCAGACAGCGTAGAGACGCGTAATCCACCATTGGTGCTT
CTCGGTGGAGGGCGCGATACTGCTGGTCCTAAGCAAGAACAGTATACTATGGATGATAGCGTGATTAGTGAAAAA
GTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTATGGAATGGCACGGATCTATTTGAGGAAGGTCGCGAACCA
GAGATGGAATGGACGGGTATCATGGGATTTACATCTAATGGAGAGCCAATTGTTGGACCGATACCTGAGCTGGAC
GGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGGCTGAGGCTGTTGCTGGT
ATGATTGTAGCAAAATTGACGAACAAGGAGTGGGAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGG
AATCTCTAA
Transcript >AgabiH97|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAAATCCCAACTTCTG
AATCAGCAGGCCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGCTCCGGTGCTACTGGGAGG
AACGGTGGGCATCTCACAAGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCG
AAGAAAAGCTATCTTATTGAGGAACATGTGGCGAAGTCGATTGTGAACACTATCCATTCACATGGTTTGGTCGAT
GCGGTCGACCTCGTCCAGGGGGATCATATTACACTATTCTTCGAGGACGAGGAGGCTCAGCTGGCTTTGCGAGAT
TACAAAGATGCACAAGCAAATGGACTAGACTTGAAAGGTGTGGAGTTTCTTGACAGAGGCGCAATGATGGAGAGA
TATGGGGTCAACTATCCTGGCGTTTTTTTTCCCTCCCATAATCTTTGGCCTCTGAAACTTGTTACGTTTCTATAC
AACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTACATACTCTCACTCCTGTCACATCTGTTCTTCCGTCT
ACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAATGGACCGTAGAAACACCTCGAGGCTCATTGAATTGC
AATAACATAATCCACGCTACAAATGCCTACGCCTCTTACCTTCTACCTCAATATCAGGACCAAATAATACCTACC
CGTGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTAGACCGTCTGCTACATCATTCCTGGGGAGCAAATTGG
GGATACGAGTACTGGTTTCCGAGGCCAGAGGAAATTTCAGACAGCGTAGAGACGCGTAATCCACCATTGGTGCTT
CTCGGTGGAGGGCGCGATACTGCTGGTCCTAAGCAAGAACAGTATACTATGGATGATAGCGTGATTAGTGAAAAA
GTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTATGGAATGGCACGGATCTATTTGAGGAAGGTCGCGAACCA
GAGATGGAATGGACGGGTATCATGGGATTTACATCTAATGGAGAGCCAATTGTTGGACCGATACCTGAGCTGGAC
GGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGGCTGAGGCTGTTGCTGGT
ATGATTGTAGCAAAATTGACGAACAAGGAGTGGGAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGG
AATCTCTAA
Gene >AgabiH97|026670
ATGCCTAAACATTCACGCTTGTTCACATATAGCTTTTTATTTCTGACCCTCTCTTCGTCGAAATCCCAACTTCTG
AATCAGCAGGCCCCTTGGTCACTCTCCAACTATTCCCGGCCGCCATGGTTGACACTTCCTGTCACCAATCCGACC
AAGTCCTTCTGGATAGACAAACCGGGTGTCAACCCACTGGCACGCGAAGGAAGTACAGGTACTTTGGGTTTCGGA
GATGAGGATGTAGATGTATGTGTCATTGGATCTGGAATAACTGGAATATCGGCTGTCTACCATCTTCAAAGGCTG
CTTGATGCGCAAGGTATCGATAAGAAAGTGGTTGTCCTAGAAGCACGTGAATTCTGTGAGTAGAAATATATACTC
GAGAGATATAAGTCATATCGACTCAGAGGGGAATCAGGCTCCGGTGCTACTGGGAGGAACGGTGGGCATCTCACA
AGGAACTTCTTCCACGACTTTGGTTCCCGTGAAAGTCATTATGGAACAGAGAATGCGAAGAAAAGCTATCTTATT
GAGGAACATGTGGCGAAGTCGATTGTGAACACTATCCATTCACATGGTTTGGTCGATGCGGTCGACCTCGTCCAG
GGGGATCATATTACACTATTCTTCGAGGACGAGGAGGCTCAGCTGGCTTTGCGAGATTACAAAGATGCACAAGCA
AATGGACTAGACTTGAAAGGTGTGGAGTTTCTTGACAGAGGCGCAATGATGGAGGTATGGACTCATTCAACGAGC
CGAAGTCTAACACTAATCAAGTTATATTCATAGAGATATGGGGTCAACTATCCTGGCGTTTTTTTTCCCTCCCAT
AATCTTTGGCCTCTGAAACTTGTTACGTTTCTATACAACTCTTCACTTTCAAGATCATCATCTAAGGTCAAACTA
CATACTCTCACTCCTGTCACATCTGTTCTTCCGTCTACTCTGGAGGGTCACACATTTCCTCAAAGAGAATCAAAA
TGGACCGTAGAAACACCTCGAGGCTCATTGAATTGCAATAACATAATCCACGCTACAAATGCCTACGCCTCTTAC
CTTCTACCTCAATATCAGGACCAAATAATACCTACCCGTGGACAAATGACTGCTCTGCGGGCAAAATCTTCTCTA
GACCGTCTGCTACATCATTCCTGGGGAGCAAATTGGGGATACGAGTACTGGTTTCCGAGGCCAGAGGAAATTTCA
GACAGCGTAGAGACGCGTAATCCACCATTGGTGCTTCTCGGTGGAGGGCGCGATACTGCTGGTCCTAAGCAAGAA
CAGTATACTATGGATGATAGCGTGATTAGTGAAAAAGTAAGTAAGACGTTGAATCGTTTCTTGCCGGAGCTATGG
AATGGCACGGATCTATTTGAGGAAGGTCGCGAACCAGAGATGGAATGGGCGAGTTACCGATCTAATTCATCATTC
CACACTGAAAGGATTCATAATTTGATAGACGGGTATCATGGGATTTACATCTAATGGAGAGCCAATTGTTGGACC
GATACCTGAGCTGGACGGGCAATACATTGCTGCGGGATTTACGGGACACGGGATGCCTCGAGCTTTTGCTGCGTA
CGTCAGAATTATTCTTTAATCTCGTCGCAGCTTCTTATCAAGTTCAAAGGGCTGAGGCTGTTGCTGGTATGATTG
TAGCAAAATTGACGAACAAGGAGTGGGAAGCACCGGAATGGCTGCCGGAGCATTACCTCACCAGTTGGAATCTCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail