Fungal Genomics

Agaricus bisporus var bisporus H39 Agaricus bisporus var bisporus H97 Agaricus bisporus var burnettii H119p4 Aspergillus niger CBS 112.32 Aspergillus niger CBS 113.50 Aspergillus niger CBS 115988 Aspergillus niger CBS 115989 Aspergillus niger CBS 118.52 Aspergillus niger CBS 124.48 Aspergillus niger CBS 131.52 Aspergillus niger CBS 133816 Aspergillus niger CBS 147320 Aspergillus niger CBS 147321 Aspergillus niger CBS 147322 Aspergillus niger CBS 147323 Aspergillus niger CBS 147324 Aspergillus niger CBS 147343 Aspergillus niger CBS 147344 Aspergillus niger CBS 147345 Aspergillus niger CBS 147346 Aspergillus niger CBS 147347 Aspergillus niger CBS 147352 Aspergillus niger CBS 147353 Aspergillus niger CBS 147371 Aspergillus niger CBS 147482 Aspergillus niger CBS 630.78 Aspergillus niger CBS 769.97 Niveomyces coronatus CBS 149186 Ophiocordyceps australis 1348a (Ghana) Ophiocordyceps australis map64 (Brazil) Ophiocordyceps camponoti-floridani Ophiocordyceps camponoti-rufipedis Ophiocordyceps kimflemingae Ophiocordyceps subramaniannii Penicillium roqueforti DTO002I6 Penicillium roqueforti DTO003C3 Penicillium roqueforti DTO003H1 (CBS 147308) Penicillium roqueforti DTO006G1 Penicillium roqueforti DTO006G7 Penicillium roqueforti DTO012A1 Penicillium roqueforti DTO012A2 (CBS 147309) Penicillium roqueforti DTO012A6 (CBS 147310) Penicillium roqueforti DTO012A7 Penicillium roqueforti DTO012A8 Penicillium roqueforti DTO012A9 Penicillium roqueforti DTO013E5 Penicillium roqueforti DTO013F2 Penicillium roqueforti DTO013F5 (CBS 147311) Penicillium roqueforti DTO027I6 Penicillium roqueforti DTO032C6 Penicillium roqueforti DTO039G3 Penicillium roqueforti DTO046C5 Penicillium roqueforti DTO070G2 (CBS 147317) Penicillium roqueforti DTO081F9 (CBS 147318) Penicillium roqueforti DTO101D6 (CBS 147325) Penicillium roqueforti DTO102I9 (CBS 147326) Penicillium roqueforti DTO126G2 (CBS 147330) Penicillium roqueforti DTO127F7 (CBS 147331) Penicillium roqueforti DTO127F9 (CBS 147332) Penicillium roqueforti DTO130C1 (CBS 147333) Penicillium roqueforti DTO163C3 (CBS 147337) Penicillium roqueforti DTO163F5 (CBS 147338) Penicillium roqueforti DTO163G4 (CBS 147339) Penicillium roqueforti DTO265D5 (CBS 147372) Penicillium roqueforti DTO369A1 (CBS 147354) Penicillium roqueforti DTO375B1 (CBS 147355) Penicillium roqueforti DTO377G2 (LCP 96.3914a) Penicillium roqueforti LCP96 04111 Rhodonia placenta FPRL280 Torrubiellomyces zombiae CBS 149187

General Properties

Protein ID	AgabiH97|026630
Gene name
Location	scaffold_11:1295302..1296444
Strand	-
Gene length (bp)	1142
Transcript length (bp)	654
Coding sequence length (bp)	654
Protein length (aa)	218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF07510	DUF1524	Protein of unknown function (DUF1524)	4.8E-06	112	171

Swissprot hits

Swissprot ID	Swissprot Description	Start	End	E-value
sp|D4AK18|A4619_ARTBC	Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2	42	217	3.0E-64

GO

(None)

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
Yes	1 - 25	0.45

Transmembrane Domains

Domain #	Start	End	Length
1	7	29	22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label	Description	Expression (RPKM)	Confidence interval (low)	Confidence interval (high)
Casing	Casing mycelium	12.81	5.50	20.13
Initials	Initials knots	1.15	0.12	2.18
Pileal_Stipeal_center	Stage I stipe center	0.15	0.00	0.40
Pileal_Stipeal_shell	Stage I stipe shell	0.04	0.00	0.16
DIF_stipe_center	Stage II stipe center	0.04	0.00	0.17
DIF_stipe_shell	Stage II stipe shell	0.11	0.00	0.33
DIF_stipe_skin	Stage II stipe skin	0.08	0.00	0.30
DIF_cap_skin	Stage II cap skin	0.04	0.00	0.17
DIF_cap_tissue	Stage II cap tissue	0.00	0.00	0.00
DIF_gill_tissue	Stage II gill tissue	0.00	0.00	0.00
YFB_stipe_center	Young fruiting body stipe center	0.13	0.00	0.40
YFB_stipe_shell	Young fruiting body stipe shell	0.10	0.00	0.28
YFB_stipe_skin	Young fruiting body stipe skin	0.14	0.00	0.40
YFB_cap_skin	Young fruiting body cap skin	0.07	0.00	0.25
YFB_cap_tissue	Young fruiting body cap tissue	0.03	0.00	0.16
YFB_gill_tissue	Young fruiting body gill tissue	0.00	0.00	0.00
YFB_veil	Young fruiting body veil	0.02	0.00	0.15

Differential expression

Label1	Label2	Q-value	Significant difference
Casing	DIF_gill_tissue	0.000613	yes
Casing	YFB_stipe_center	0.220912	no
Casing	YFB_stipe_shell	0.319503	no
Casing	YFB_stipe_skin	0.223147	no
Casing	YFB_cap_skin	0.411844	no
Casing	YFB_cap_tissue	0.516131	no
Casing	YFB_gill_tissue	0.000613	yes
Casing	YFB_veil	0.472380	no
Casing	Initials	0.000613	yes
Casing	Pileal_Stipeal_center	0.193015	no
Casing	Pileal_Stipeal_shell	0.508681	no
Casing	DIF_stipe_center	0.508322	no
Casing	DIF_stipe_shell	0.278179	no
Casing	DIF_stipe_skin	0.378231	no
Casing	DIF_cap_skin	0.512033	no
Casing	DIF_cap_tissue	0.000613	yes
DIF_gill_tissue	YFB_stipe_center	1.000000	no
DIF_gill_tissue	YFB_stipe_shell	1.000000	no
DIF_gill_tissue	YFB_stipe_skin	1.000000	no
DIF_gill_tissue	YFB_cap_skin	1.000000	no
DIF_gill_tissue	YFB_cap_tissue	1.000000	no
DIF_gill_tissue	YFB_gill_tissue	1.000000	no
DIF_gill_tissue	YFB_veil	1.000000	no
YFB_stipe_center	YFB_stipe_shell	1.000000	no
YFB_stipe_center	YFB_stipe_skin	1.000000	no
YFB_stipe_center	YFB_cap_skin	1.000000	no
YFB_stipe_center	YFB_cap_tissue	1.000000	no
YFB_stipe_center	YFB_gill_tissue	1.000000	no
YFB_stipe_center	YFB_veil	1.000000	no
YFB_stipe_shell	YFB_stipe_skin	1.000000	no
YFB_stipe_shell	YFB_cap_skin	1.000000	no
YFB_stipe_shell	YFB_cap_tissue	1.000000	no
YFB_stipe_shell	YFB_gill_tissue	1.000000	no
YFB_stipe_shell	YFB_veil	1.000000	no
YFB_stipe_skin	YFB_cap_skin	1.000000	no
YFB_stipe_skin	YFB_cap_tissue	1.000000	no
YFB_stipe_skin	YFB_gill_tissue	1.000000	no
YFB_stipe_skin	YFB_veil	1.000000	no
YFB_cap_skin	YFB_cap_tissue	1.000000	no
YFB_cap_skin	YFB_gill_tissue	1.000000	no
YFB_cap_skin	YFB_veil	1.000000	no
YFB_cap_tissue	YFB_gill_tissue	1.000000	no
YFB_cap_tissue	YFB_veil	1.000000	no
YFB_gill_tissue	YFB_veil	1.000000	no
Initials	DIF_gill_tissue	0.000613	yes
Initials	YFB_stipe_center	0.230028	no
Initials	YFB_stipe_shell	0.319589	no
Initials	YFB_stipe_skin	0.245540	no
Initials	YFB_cap_skin	0.411844	no
Initials	YFB_cap_tissue	0.516131	no
Initials	YFB_gill_tissue	0.000613	yes
Initials	YFB_veil	0.472380	no
Initials	Pileal_Stipeal_center	0.228711	no
Initials	Pileal_Stipeal_shell	0.508681	no
Initials	DIF_stipe_center	0.508322	no
Initials	DIF_stipe_shell	0.280162	no
Initials	DIF_stipe_skin	0.378231	no
Initials	DIF_cap_skin	0.512033	no
Initials	DIF_cap_tissue	0.000613	yes
Pileal_Stipeal_center	DIF_gill_tissue	1.000000	no
Pileal_Stipeal_center	YFB_stipe_center	1.000000	no
Pileal_Stipeal_center	YFB_stipe_shell	1.000000	no
Pileal_Stipeal_center	YFB_stipe_skin	1.000000	no
Pileal_Stipeal_center	YFB_cap_skin	1.000000	no
Pileal_Stipeal_center	YFB_cap_tissue	1.000000	no
Pileal_Stipeal_center	YFB_gill_tissue	1.000000	no
Pileal_Stipeal_center	YFB_veil	1.000000	no
Pileal_Stipeal_center	Pileal_Stipeal_shell	1.000000	no
Pileal_Stipeal_center	DIF_stipe_center	1.000000	no
Pileal_Stipeal_center	DIF_stipe_shell	1.000000	no
Pileal_Stipeal_center	DIF_stipe_skin	1.000000	no
Pileal_Stipeal_center	DIF_cap_skin	1.000000	no
Pileal_Stipeal_center	DIF_cap_tissue	1.000000	no
Pileal_Stipeal_shell	DIF_gill_tissue	1.000000	no
Pileal_Stipeal_shell	YFB_stipe_center	1.000000	no
Pileal_Stipeal_shell	YFB_stipe_shell	1.000000	no
Pileal_Stipeal_shell	YFB_stipe_skin	1.000000	no
Pileal_Stipeal_shell	YFB_cap_skin	1.000000	no
Pileal_Stipeal_shell	YFB_cap_tissue	1.000000	no
Pileal_Stipeal_shell	YFB_gill_tissue	1.000000	no
Pileal_Stipeal_shell	YFB_veil	1.000000	no
Pileal_Stipeal_shell	DIF_stipe_center	1.000000	no
Pileal_Stipeal_shell	DIF_stipe_shell	1.000000	no
Pileal_Stipeal_shell	DIF_stipe_skin	1.000000	no
Pileal_Stipeal_shell	DIF_cap_skin	1.000000	no
Pileal_Stipeal_shell	DIF_cap_tissue	1.000000	no
DIF_stipe_center	DIF_gill_tissue	1.000000	no
DIF_stipe_center	YFB_stipe_center	1.000000	no
DIF_stipe_center	YFB_stipe_shell	1.000000	no
DIF_stipe_center	YFB_stipe_skin	1.000000	no
DIF_stipe_center	YFB_cap_skin	1.000000	no
DIF_stipe_center	YFB_cap_tissue	1.000000	no
DIF_stipe_center	YFB_gill_tissue	1.000000	no
DIF_stipe_center	YFB_veil	1.000000	no
DIF_stipe_center	DIF_stipe_shell	1.000000	no
DIF_stipe_center	DIF_stipe_skin	1.000000	no
DIF_stipe_center	DIF_cap_skin	1.000000	no
DIF_stipe_center	DIF_cap_tissue	1.000000	no
DIF_stipe_shell	DIF_gill_tissue	1.000000	no
DIF_stipe_shell	YFB_stipe_center	1.000000	no
DIF_stipe_shell	YFB_stipe_shell	1.000000	no
DIF_stipe_shell	YFB_stipe_skin	1.000000	no
DIF_stipe_shell	YFB_cap_skin	1.000000	no
DIF_stipe_shell	YFB_cap_tissue	1.000000	no
DIF_stipe_shell	YFB_gill_tissue	1.000000	no
DIF_stipe_shell	YFB_veil	1.000000	no
DIF_stipe_shell	DIF_stipe_skin	1.000000	no
DIF_stipe_shell	DIF_cap_skin	1.000000	no
DIF_stipe_shell	DIF_cap_tissue	1.000000	no
DIF_stipe_skin	DIF_gill_tissue	1.000000	no
DIF_stipe_skin	YFB_stipe_center	1.000000	no
DIF_stipe_skin	YFB_stipe_shell	1.000000	no
DIF_stipe_skin	YFB_stipe_skin	1.000000	no
DIF_stipe_skin	YFB_cap_skin	1.000000	no
DIF_stipe_skin	YFB_cap_tissue	1.000000	no
DIF_stipe_skin	YFB_gill_tissue	1.000000	no
DIF_stipe_skin	YFB_veil	1.000000	no
DIF_stipe_skin	DIF_cap_skin	1.000000	no
DIF_stipe_skin	DIF_cap_tissue	1.000000	no
DIF_cap_skin	DIF_gill_tissue	1.000000	no
DIF_cap_skin	YFB_stipe_center	1.000000	no
DIF_cap_skin	YFB_stipe_shell	1.000000	no
DIF_cap_skin	YFB_stipe_skin	1.000000	no
DIF_cap_skin	YFB_cap_skin	1.000000	no
DIF_cap_skin	YFB_cap_tissue	1.000000	no
DIF_cap_skin	YFB_gill_tissue	1.000000	no
DIF_cap_skin	YFB_veil	1.000000	no
DIF_cap_skin	DIF_cap_tissue	1.000000	no
DIF_cap_tissue	DIF_gill_tissue	1.000000	no
DIF_cap_tissue	YFB_stipe_center	1.000000	no
DIF_cap_tissue	YFB_stipe_shell	1.000000	no
DIF_cap_tissue	YFB_stipe_skin	1.000000	no
DIF_cap_tissue	YFB_cap_skin	1.000000	no
DIF_cap_tissue	YFB_cap_tissue	1.000000	no
DIF_cap_tissue	YFB_gill_tissue	1.000000	no
DIF_cap_tissue	YFB_veil	1.000000	no

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>AgabiH97|026630 MKTLSSYLSILFLFLSFSNLNVLAAPILGRNVYSRSLPTPISVATAKTQLSQLRVAADSNSPAYDRNRFKTWDII SGNCDTRETVLKRDGTSVVTDTACRATSGHWVSAYDNVATNLASDLDIDHVVPLKEAWISGARDWTDAQREAFAN DLTRPQLIAVTDNLNQSKGDRDIANWIPPAGGFVCTYARAWVQVKHFYGLTIDSAEKSAITNILNGC*
Coding	>AgabiH97|026630 ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Transcript	>AgabiH97|026630 ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Gene	>AgabiH97|026630 ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT TCCCAATGTGAGCTTTTTTTCATTTTTTTTTTGTGCGAGTTGGTTTTGATGATTGTTTTTGGTTTTTTGAATTAG TGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCAGTACGTGTC GAAGACTACTAAATGTCTTTTACCGATTGTGTTTTTTCATAGTTTCTGGAAATTGTGATACCCGTGAAAGTAAGT CTCTCTCTCAAAAAGCGAAATAATATGCATCGAGAAAATTCATTCATATCCTTTAGCCGTTTTGAAGAGAGATGG AACGAGCGTAGTAACCGACACTGCTTGTAGAGCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGAC CAACTTGGCTAGTGACCTTGACATCGTGAGTATATTAAATGATTTATCTGGCTTTTCAACCGCATGTTGATAATA TTCATTTAGGACCACGTCGTCCCTCTTAAAGAGGTAAAGAGTCGCTTTTCATCTCACGATAAAGACGACGGTTTT TTGATTCCCTCACTATTTTTGCAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTT GCCAATGATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAAGTAAGTAAAAAATAGATCTGTGTTCTAAATC CAAGGAGATAACTAACCGCGATTTTTCGTTACAATATAGCCTTAATCAGTCTAAAGGTACGCGACGGTCATTTGT TGTTATCTAGATGAGGTTGATTAAACGTGATATTTCTAGGAGACAGAGGTCAGTGATTATACTTTGACGGATTGT AGGCCCTGACTCAATATAACTTTATAGATATCGCGAATTGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATG CTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTTACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACA TCCTCAATGGTTGCTGA