Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026630
Gene name
Locationscaffold_11:1295302..1296444
Strand-
Gene length (bp)1142
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07510 DUF1524 Protein of unknown function (DUF1524) 4.8E-06 112 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK18|A4619_ARTBC Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2 42 217 3.0E-64

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 12.81 5.50 20.13
Initials Initials knots 1.15 0.12 2.18
Pileal_Stipeal_center Stage I stipe center 0.15 0.00 0.40
Pileal_Stipeal_shell Stage I stipe shell 0.04 0.00 0.16
DIF_stipe_center Stage II stipe center 0.04 0.00 0.17
DIF_stipe_shell Stage II stipe shell 0.11 0.00 0.33
DIF_stipe_skin Stage II stipe skin 0.08 0.00 0.30
DIF_cap_skin Stage II cap skin 0.04 0.00 0.17
DIF_cap_tissue Stage II cap tissue 0.00 0.00 0.00
DIF_gill_tissue Stage II gill tissue 0.00 0.00 0.00
YFB_stipe_center Young fruiting body stipe center 0.13 0.00 0.40
YFB_stipe_shell Young fruiting body stipe shell 0.10 0.00 0.28
YFB_stipe_skin Young fruiting body stipe skin 0.14 0.00 0.40
YFB_cap_skin Young fruiting body cap skin 0.07 0.00 0.25
YFB_cap_tissue Young fruiting body cap tissue 0.03 0.00 0.16
YFB_gill_tissue Young fruiting body gill tissue 0.00 0.00 0.00
YFB_veil Young fruiting body veil 0.02 0.00 0.15

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.220912 no
Casing YFB_stipe_shell 0.319503 no
Casing YFB_stipe_skin 0.223147 no
Casing YFB_cap_skin 0.411844 no
Casing YFB_cap_tissue 0.516131 no
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.472380 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.193015 no
Casing Pileal_Stipeal_shell 0.508681 no
Casing DIF_stipe_center 0.508322 no
Casing DIF_stipe_shell 0.278179 no
Casing DIF_stipe_skin 0.378231 no
Casing DIF_cap_skin 0.512033 no
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 1.000000 no
DIF_gill_tissue YFB_stipe_shell 1.000000 no
DIF_gill_tissue YFB_stipe_skin 1.000000 no
DIF_gill_tissue YFB_cap_skin 1.000000 no
DIF_gill_tissue YFB_cap_tissue 1.000000 no
DIF_gill_tissue YFB_gill_tissue 1.000000 no
DIF_gill_tissue YFB_veil 1.000000 no
YFB_stipe_center YFB_stipe_shell 1.000000 no
YFB_stipe_center YFB_stipe_skin 1.000000 no
YFB_stipe_center YFB_cap_skin 1.000000 no
YFB_stipe_center YFB_cap_tissue 1.000000 no
YFB_stipe_center YFB_gill_tissue 1.000000 no
YFB_stipe_center YFB_veil 1.000000 no
YFB_stipe_shell YFB_stipe_skin 1.000000 no
YFB_stipe_shell YFB_cap_skin 1.000000 no
YFB_stipe_shell YFB_cap_tissue 1.000000 no
YFB_stipe_shell YFB_gill_tissue 1.000000 no
YFB_stipe_shell YFB_veil 1.000000 no
YFB_stipe_skin YFB_cap_skin 1.000000 no
YFB_stipe_skin YFB_cap_tissue 1.000000 no
YFB_stipe_skin YFB_gill_tissue 1.000000 no
YFB_stipe_skin YFB_veil 1.000000 no
YFB_cap_skin YFB_cap_tissue 1.000000 no
YFB_cap_skin YFB_gill_tissue 1.000000 no
YFB_cap_skin YFB_veil 1.000000 no
YFB_cap_tissue YFB_gill_tissue 1.000000 no
YFB_cap_tissue YFB_veil 1.000000 no
YFB_gill_tissue YFB_veil 1.000000 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.230028 no
Initials YFB_stipe_shell 0.319589 no
Initials YFB_stipe_skin 0.245540 no
Initials YFB_cap_skin 0.411844 no
Initials YFB_cap_tissue 0.516131 no
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.472380 no
Initials Pileal_Stipeal_center 0.228711 no
Initials Pileal_Stipeal_shell 0.508681 no
Initials DIF_stipe_center 0.508322 no
Initials DIF_stipe_shell 0.280162 no
Initials DIF_stipe_skin 0.378231 no
Initials DIF_cap_skin 0.512033 no
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_stipe_center 1.000000 no
Pileal_Stipeal_center YFB_stipe_shell 1.000000 no
Pileal_Stipeal_center YFB_stipe_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_tissue 1.000000 no
Pileal_Stipeal_center YFB_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_veil 1.000000 no
Pileal_Stipeal_center Pileal_Stipeal_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_center 1.000000 no
Pileal_Stipeal_center DIF_stipe_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_tissue 1.000000 no
Pileal_Stipeal_shell DIF_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_stipe_center 1.000000 no
Pileal_Stipeal_shell YFB_stipe_shell 1.000000 no
Pileal_Stipeal_shell YFB_stipe_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_tissue 1.000000 no
Pileal_Stipeal_shell YFB_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_veil 1.000000 no
Pileal_Stipeal_shell DIF_stipe_center 1.000000 no
Pileal_Stipeal_shell DIF_stipe_shell 1.000000 no
Pileal_Stipeal_shell DIF_stipe_skin 1.000000 no
Pileal_Stipeal_shell DIF_cap_skin 1.000000 no
Pileal_Stipeal_shell DIF_cap_tissue 1.000000 no
DIF_stipe_center DIF_gill_tissue 1.000000 no
DIF_stipe_center YFB_stipe_center 1.000000 no
DIF_stipe_center YFB_stipe_shell 1.000000 no
DIF_stipe_center YFB_stipe_skin 1.000000 no
DIF_stipe_center YFB_cap_skin 1.000000 no
DIF_stipe_center YFB_cap_tissue 1.000000 no
DIF_stipe_center YFB_gill_tissue 1.000000 no
DIF_stipe_center YFB_veil 1.000000 no
DIF_stipe_center DIF_stipe_shell 1.000000 no
DIF_stipe_center DIF_stipe_skin 1.000000 no
DIF_stipe_center DIF_cap_skin 1.000000 no
DIF_stipe_center DIF_cap_tissue 1.000000 no
DIF_stipe_shell DIF_gill_tissue 1.000000 no
DIF_stipe_shell YFB_stipe_center 1.000000 no
DIF_stipe_shell YFB_stipe_shell 1.000000 no
DIF_stipe_shell YFB_stipe_skin 1.000000 no
DIF_stipe_shell YFB_cap_skin 1.000000 no
DIF_stipe_shell YFB_cap_tissue 1.000000 no
DIF_stipe_shell YFB_gill_tissue 1.000000 no
DIF_stipe_shell YFB_veil 1.000000 no
DIF_stipe_shell DIF_stipe_skin 1.000000 no
DIF_stipe_shell DIF_cap_skin 1.000000 no
DIF_stipe_shell DIF_cap_tissue 1.000000 no
DIF_stipe_skin DIF_gill_tissue 1.000000 no
DIF_stipe_skin YFB_stipe_center 1.000000 no
DIF_stipe_skin YFB_stipe_shell 1.000000 no
DIF_stipe_skin YFB_stipe_skin 1.000000 no
DIF_stipe_skin YFB_cap_skin 1.000000 no
DIF_stipe_skin YFB_cap_tissue 1.000000 no
DIF_stipe_skin YFB_gill_tissue 1.000000 no
DIF_stipe_skin YFB_veil 1.000000 no
DIF_stipe_skin DIF_cap_skin 1.000000 no
DIF_stipe_skin DIF_cap_tissue 1.000000 no
DIF_cap_skin DIF_gill_tissue 1.000000 no
DIF_cap_skin YFB_stipe_center 1.000000 no
DIF_cap_skin YFB_stipe_shell 1.000000 no
DIF_cap_skin YFB_stipe_skin 1.000000 no
DIF_cap_skin YFB_cap_skin 1.000000 no
DIF_cap_skin YFB_cap_tissue 1.000000 no
DIF_cap_skin YFB_gill_tissue 1.000000 no
DIF_cap_skin YFB_veil 1.000000 no
DIF_cap_skin DIF_cap_tissue 1.000000 no
DIF_cap_tissue DIF_gill_tissue 1.000000 no
DIF_cap_tissue YFB_stipe_center 1.000000 no
DIF_cap_tissue YFB_stipe_shell 1.000000 no
DIF_cap_tissue YFB_stipe_skin 1.000000 no
DIF_cap_tissue YFB_cap_skin 1.000000 no
DIF_cap_tissue YFB_cap_tissue 1.000000 no
DIF_cap_tissue YFB_gill_tissue 1.000000 no
DIF_cap_tissue YFB_veil 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026630
MKTLSSYLSILFLFLSFSNLNVLAAPILGRNVYSRSLPTPISVATAKTQLSQLRVAADSNSPAYDRNRFKTWDII
SGNCDTRETVLKRDGTSVVTDTACRATSGHWVSAYDNVATNLASDLDIDHVVPLKEAWISGARDWTDAQREAFAN
DLTRPQLIAVTDNLNQSKGDRDIANWIPPAGGFVCTYARAWVQVKHFYGLTIDSAEKSAITNILNGC*
Coding >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA
GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Transcript >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA
GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Gene >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATGTGAGCTTTTTTTCATTTTTTTTTTGTGCGAGTTGGTTTTGATGATTGTTTTTGGTTTTTTGAATTAG
TGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCAGTACGTGTC
GAAGACTACTAAATGTCTTTTACCGATTGTGTTTTTTCATAGTTTCTGGAAATTGTGATACCCGTGAAAGTAAGT
CTCTCTCTCAAAAAGCGAAATAATATGCATCGAGAAAATTCATTCATATCCTTTAGCCGTTTTGAAGAGAGATGG
AACGAGCGTAGTAACCGACACTGCTTGTAGAGCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGAC
CAACTTGGCTAGTGACCTTGACATCGTGAGTATATTAAATGATTTATCTGGCTTTTCAACCGCATGTTGATAATA
TTCATTTAGGACCACGTCGTCCCTCTTAAAGAGGTAAAGAGTCGCTTTTCATCTCACGATAAAGACGACGGTTTT
TTGATTCCCTCACTATTTTTGCAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTT
GCCAATGATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAAGTAAGTAAAAAATAGATCTGTGTTCTAAATC
CAAGGAGATAACTAACCGCGATTTTTCGTTACAATATAGCCTTAATCAGTCTAAAGGTACGCGACGGTCATTTGT
TGTTATCTAGATGAGGTTGATTAAACGTGATATTTCTAGGAGACAGAGGTCAGTGATTATACTTTGACGGATTGT
AGGCCCTGACTCAATATAACTTTATAGATATCGCGAATTGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATG
CTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTTACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACA
TCCTCAATGGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail