Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026630
Gene name
Locationscaffold_11:1295302..1296444
Strand-
Gene length (bp)1142
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07510 DUF1524 Protein of unknown function (DUF1524) 4.8E-06 112 171

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK18|A4619_ARTBC Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04619 PE=1 SV=2 42 217 3.0E-64

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026630
MKTLSSYLSILFLFLSFSNLNVLAAPILGRNVYSRSLPTPISVATAKTQLSQLRVAADSNSPAYDRNRFKTWDII
SGNCDTRETVLKRDGTSVVTDTACRATSGHWVSAYDNVATNLASDLDIDHVVPLKEAWISGARDWTDAQREAFAN
DLTRPQLIAVTDNLNQSKGDRDIANWIPPAGGFVCTYARAWVQVKHFYGLTIDSAEKSAITNILNGC*
Coding >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA
GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Transcript >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATTGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCATT
TCTGGAAATTGTGATACCCGTGAAACCGTTTTGAAGAGAGATGGAACGAGCGTAGTAACCGACACTGCTTGTAGA
GCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGACCAACTTGGCTAGTGACCTTGACATCGACCAC
GTCGTCCCTCTTAAAGAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTTGCCAAT
GATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAACCTTAATCAGTCTAAAGGAGACAGAGATATCGCGAAT
TGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATGCTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTT
ACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACATCCTCAATGGTTGCTGA
Gene >AgabiH97|026630
ATGAAAACCTTGTCGTCTTATCTCTCTATCCTTTTCTTATTCTTATCATTCAGCAATCTCAACGTTTTGGCTGCT
CCGATTTTAGGAAGGAATGTTTATTCGAGATCGTTACCTACACCTATATCTGTTGCGACCGCTAAAACTCAACTT
TCCCAATGTGAGCTTTTTTTCATTTTTTTTTTGTGCGAGTTGGTTTTGATGATTGTTTTTGGTTTTTTGAATTAG
TGAGGGTTGCTGCGGATTCGAATTCACCTGCATATGACCGAAACAGATTCAAGACTTGGGATATCAGTACGTGTC
GAAGACTACTAAATGTCTTTTACCGATTGTGTTTTTTCATAGTTTCTGGAAATTGTGATACCCGTGAAAGTAAGT
CTCTCTCTCAAAAAGCGAAATAATATGCATCGAGAAAATTCATTCATATCCTTTAGCCGTTTTGAAGAGAGATGG
AACGAGCGTAGTAACCGACACTGCTTGTAGAGCGACTTCTGGACATTGGGTTTCAGCTTATGATAATGTCGCGAC
CAACTTGGCTAGTGACCTTGACATCGTGAGTATATTAAATGATTTATCTGGCTTTTCAACCGCATGTTGATAATA
TTCATTTAGGACCACGTCGTCCCTCTTAAAGAGGTAAAGAGTCGCTTTTCATCTCACGATAAAGACGACGGTTTT
TTGATTCCCTCACTATTTTTGCAGGCCTGGATTTCGGGAGCGCGTGACTGGACTGATGCTCAAAGAGAAGCTTTT
GCCAATGATTTGACTAGGCCTCAACTTATCGCTGTGACAGACAAGTAAGTAAAAAATAGATCTGTGTTCTAAATC
CAAGGAGATAACTAACCGCGATTTTTCGTTACAATATAGCCTTAATCAGTCTAAAGGTACGCGACGGTCATTTGT
TGTTATCTAGATGAGGTTGATTAAACGTGATATTTCTAGGAGACAGAGGTCAGTGATTATACTTTGACGGATTGT
AGGCCCTGACTCAATATAACTTTATAGATATCGCGAATTGGATCCCCCCTGCAGGCGGTTTTGTCTGCACTTATG
CTAGGGCATGGGTTCAAGTAAAGCATTTCTACGGGCTTACCATTGATTCTGCCGAGAAGTCAGCTATCACTAACA
TCCTCAATGGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail