Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026520
Gene name
Locationscaffold_11:1257807..1259740
Strand+
Gene length (bp)1933
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 269 291 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 207.85 113.76 301.94
Initials Initials knots 185.35 107.46 263.25
Pileal_Stipeal_center Stage I stipe center 357.34 183.48 531.20
Pileal_Stipeal_shell Stage I stipe shell 231.64 130.02 333.27
DIF_stipe_center Stage II stipe center 217.97 124.23 311.72
DIF_stipe_shell Stage II stipe shell 366.15 193.12 539.18
DIF_stipe_skin Stage II stipe skin 387.04 200.54 573.55
DIF_cap_skin Stage II cap skin 327.11 176.36 477.86
DIF_cap_tissue Stage II cap tissue 223.28 124.14 322.42
DIF_gill_tissue Stage II gill tissue 141.39 82.56 200.22
YFB_stipe_center Young fruiting body stipe center 290.91 151.60 430.23
YFB_stipe_shell Young fruiting body stipe shell 311.14 169.01 453.28
YFB_stipe_skin Young fruiting body stipe skin 311.29 159.49 463.08
YFB_cap_skin Young fruiting body cap skin 400.73 207.75 593.70
YFB_cap_tissue Young fruiting body cap tissue 322.29 157.15 487.42
YFB_gill_tissue Young fruiting body gill tissue 369.03 196.39 541.67
YFB_veil Young fruiting body veil 289.21 157.42 421.00

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.231439 no
Casing YFB_stipe_center 0.368074 no
Casing YFB_stipe_shell 0.221032 no
Casing YFB_stipe_skin 0.235806 no
Casing YFB_cap_skin 0.031088 yes
Casing YFB_cap_tissue 0.220912 no
Casing YFB_gill_tissue 0.063954 no
Casing YFB_veil 0.353355 no
Casing Initials 0.816602 no
Casing Pileal_Stipeal_center 0.104748 no
Casing Pileal_Stipeal_shell 0.835071 no
Casing DIF_stipe_center 0.935884 no
Casing DIF_stipe_shell 0.075194 no
Casing DIF_stipe_skin 0.045273 yes
Casing DIF_cap_skin 0.168144 no
Casing DIF_cap_tissue 0.896965 no
DIF_gill_tissue YFB_stipe_center 0.016104 yes
DIF_gill_tissue YFB_stipe_shell 0.005302 yes
DIF_gill_tissue YFB_stipe_skin 0.006387 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.008121 yes
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.007439 yes
YFB_stipe_center YFB_stipe_shell 0.910091 no
YFB_stipe_center YFB_stipe_skin 0.911976 no
YFB_stipe_center YFB_cap_skin 0.420563 no
YFB_stipe_center YFB_cap_tissue 0.860774 no
YFB_stipe_center YFB_gill_tissue 0.574839 no
YFB_stipe_center YFB_veil 0.991834 no
YFB_stipe_shell YFB_stipe_skin 0.999212 no
YFB_stipe_shell YFB_cap_skin 0.537117 no
YFB_stipe_shell YFB_cap_tissue 0.956269 no
YFB_stipe_shell YFB_gill_tissue 0.708441 no
YFB_stipe_shell YFB_veil 0.896458 no
YFB_stipe_skin YFB_cap_skin 0.552303 no
YFB_stipe_skin YFB_cap_tissue 0.956779 no
YFB_stipe_skin YFB_gill_tissue 0.717483 no
YFB_stipe_skin YFB_veil 0.896851 no
YFB_cap_skin YFB_cap_tissue 0.640545 no
YFB_cap_skin YFB_gill_tissue 0.884603 no
YFB_cap_skin YFB_veil 0.372152 no
YFB_cap_tissue YFB_gill_tissue 0.798463 no
YFB_cap_tissue YFB_veil 0.847493 no
YFB_gill_tissue YFB_veil 0.547798 no
Initials DIF_gill_tissue 0.437800 no
Initials YFB_stipe_center 0.167110 no
Initials YFB_stipe_shell 0.080883 no
Initials YFB_stipe_skin 0.094984 no
Initials YFB_cap_skin 0.006742 yes
Initials YFB_cap_tissue 0.090321 no
Initials YFB_gill_tissue 0.016104 yes
Initials YFB_veil 0.149200 no
Initials Pileal_Stipeal_center 0.038495 yes
Initials Pileal_Stipeal_shell 0.577040 no
Initials DIF_stipe_center 0.708992 no
Initials DIF_stipe_shell 0.024698 yes
Initials DIF_stipe_skin 0.013782 yes
Initials DIF_cap_skin 0.059513 no
Initials DIF_cap_tissue 0.656886 no
Pileal_Stipeal_center DIF_gill_tissue 0.002084 yes
Pileal_Stipeal_center YFB_stipe_center 0.671439 no
Pileal_Stipeal_center YFB_stipe_shell 0.790595 no
Pileal_Stipeal_center YFB_stipe_skin 0.799163 no
Pileal_Stipeal_center YFB_cap_skin 0.839196 no
Pileal_Stipeal_center YFB_cap_tissue 0.864757 no
Pileal_Stipeal_center YFB_gill_tissue 0.960358 no
Pileal_Stipeal_center YFB_veil 0.641031 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.214129 no
Pileal_Stipeal_center DIF_stipe_center 0.132709 no
Pileal_Stipeal_center DIF_stipe_shell 0.970760 no
Pileal_Stipeal_center DIF_stipe_skin 0.896025 no
Pileal_Stipeal_center DIF_cap_skin 0.880222 no
Pileal_Stipeal_center DIF_cap_tissue 0.167110 no
Pileal_Stipeal_shell DIF_gill_tissue 0.092675 no
Pileal_Stipeal_shell YFB_stipe_center 0.600726 no
Pileal_Stipeal_shell YFB_stipe_shell 0.425166 no
Pileal_Stipeal_shell YFB_stipe_skin 0.441504 no
Pileal_Stipeal_shell YFB_cap_skin 0.082277 no
Pileal_Stipeal_shell YFB_cap_tissue 0.399522 no
Pileal_Stipeal_shell YFB_gill_tissue 0.147817 no
Pileal_Stipeal_shell YFB_veil 0.592238 no
Pileal_Stipeal_shell DIF_stipe_center 0.915950 no
Pileal_Stipeal_shell DIF_stipe_shell 0.169705 no
Pileal_Stipeal_shell DIF_stipe_skin 0.104587 no
Pileal_Stipeal_shell DIF_cap_skin 0.336860 no
Pileal_Stipeal_shell DIF_cap_tissue 0.950703 no
DIF_stipe_center DIF_gill_tissue 0.153005 no
DIF_stipe_center YFB_stipe_center 0.458854 no
DIF_stipe_center YFB_stipe_shell 0.294241 no
DIF_stipe_center YFB_stipe_skin 0.310583 no
DIF_stipe_center YFB_cap_skin 0.048834 yes
DIF_stipe_center YFB_cap_tissue 0.285140 no
DIF_stipe_center YFB_gill_tissue 0.092841 no
DIF_stipe_center YFB_veil 0.444000 no
DIF_stipe_center DIF_stipe_shell 0.108700 no
DIF_stipe_center DIF_stipe_skin 0.064520 no
DIF_stipe_center DIF_cap_skin 0.229251 no
DIF_stipe_center DIF_cap_tissue 0.966429 no
DIF_stipe_shell DIF_gill_tissue 0.001625 yes
DIF_stipe_shell YFB_stipe_center 0.610881 no
DIF_stipe_shell YFB_stipe_shell 0.736166 no
DIF_stipe_shell YFB_stipe_skin 0.746615 no
DIF_stipe_shell YFB_cap_skin 0.875140 no
DIF_stipe_shell YFB_cap_tissue 0.820475 no
DIF_stipe_shell YFB_gill_tissue 0.989064 no
DIF_stipe_shell YFB_veil 0.574839 no
DIF_stipe_shell DIF_stipe_skin 0.928804 no
DIF_stipe_shell DIF_cap_skin 0.834647 no
DIF_stipe_shell DIF_cap_tissue 0.127489 no
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.484539 no
DIF_stipe_skin YFB_stipe_shell 0.610165 no
DIF_stipe_skin YFB_stipe_skin 0.626598 no
DIF_stipe_skin YFB_cap_skin 0.956338 no
DIF_stipe_skin YFB_cap_tissue 0.713197 no
DIF_stipe_skin YFB_gill_tissue 0.938913 no
DIF_stipe_skin YFB_veil 0.447623 no
DIF_stipe_skin DIF_cap_skin 0.725918 no
DIF_stipe_skin DIF_cap_tissue 0.080708 no
DIF_cap_skin DIF_gill_tissue 0.004548 yes
DIF_cap_skin YFB_stipe_center 0.829461 no
DIF_cap_skin YFB_stipe_shell 0.934639 no
DIF_cap_skin YFB_stipe_skin 0.936643 no
DIF_cap_skin YFB_cap_skin 0.655821 no
DIF_cap_skin YFB_cap_tissue 0.982217 no
DIF_cap_skin YFB_gill_tissue 0.815123 no
DIF_cap_skin YFB_veil 0.811503 no
DIF_cap_skin DIF_cap_tissue 0.262471 no
DIF_cap_tissue DIF_gill_tissue 0.128073 no
DIF_cap_tissue YFB_stipe_center 0.511724 no
DIF_cap_tissue YFB_stipe_shell 0.340799 no
DIF_cap_tissue YFB_stipe_skin 0.356963 no
DIF_cap_tissue YFB_cap_skin 0.059121 no
DIF_cap_tissue YFB_cap_tissue 0.325695 no
DIF_cap_tissue YFB_gill_tissue 0.112109 no
DIF_cap_tissue YFB_veil 0.500352 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026520
MSSSLVLRLLFGASIFALHAAGQNSQLRFNWKFENDATPQRVPICQDFPIVVIPDPKNTTAGNFIGTPPYYMMSF
PQGGQPITQLIGNTNDTLSWTPKHPVGTNFSLQLMDSDGFTGGDGGLIYQVVENPEGQDCAAPTPPNDFTITSNV
TDGGRVETCHFWRLNINGGESPYTVVLNAVNSPVITNISLSDGNNAVVYSNRADPDTTLFAGVVDKTGRWATGTQ
YISTFGSIDYACIGFRTIVTTQKELDDAEKAREDSQRSKKRTAIIVGVVVSVAGVLFIAGAIAFWIHRRRRLESL
KPDIEPRKFMDSGPSGQVLSVTQFMASSPNHTPSSGKTAFSPIGSLPYSIEPFSDDRRDSTADQSQPHFHLTSSS
GTDQRGGPSFAQFPMSSVRRSGKAREAAQTTLAHHDRSQMLSSSARLLPDWPVRSASLQPPHHDSMSTSAMESEI
IYQHQDAGQVVRELPPPYIPPHLQENSGVTFR*
Coding >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATC
GTTGTGATTCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTT
CCTCAGGGAGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCC
GTTGGCACTAATTTCTCACTACAATTAATGGATTCGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAG
GTCGTCGAAAATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAATGATTTCACTATCACCTCAAACGTT
ACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAATGGAGGAGAATCACCCTATACGGTC
GTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGACGGCAACAACGCTGTGGTCTATAGT
AATCGTGCTGACCCAGACACTACACTTTTCGCCGGCGTCGTTGACAAAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTC
GATGACGCGGAAAAAGCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTC
TCGGTGGCCGGGGTACTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTA
AAGCCAGACATTGAGCCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATG
GCTTCGAGCCCCAACCACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATA
GAACCCTTCAGCGATGATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGT
GGTACAGATCAACGGGGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGA
GAAGCTGCACAAACAACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGAC
TGGCCGGTTCGTTCGGCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATT
ATATATCAGCATCAGGATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAA
AATTCTGGAGTTACGTTCAGGTAA
Transcript >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATC
GTTGTGATTCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTT
CCTCAGGGAGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCC
GTTGGCACTAATTTCTCACTACAATTAATGGATTCGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAG
GTCGTCGAAAATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAATGATTTCACTATCACCTCAAACGTT
ACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAATGGAGGAGAATCACCCTATACGGTC
GTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGACGGCAACAACGCTGTGGTCTATAGT
AATCGTGCTGACCCAGACACTACACTTTTCGCCGGCGTCGTTGACAAAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTC
GATGACGCGGAAAAAGCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTC
TCGGTGGCCGGGGTACTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTA
AAGCCAGACATTGAGCCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATG
GCTTCGAGCCCCAACCACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATA
GAACCCTTCAGCGATGATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGT
GGTACAGATCAACGGGGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGA
GAAGCTGCACAAACAACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGAC
TGGCCGGTTCGTTCGGCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATT
ATATATCAGCATCAGGATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAA
AATTCTGGAGTTACGTTCAGGTAA
Gene >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGTAAGTATAGAGCGTGGCCTTTTCTCTCCCTCTCTCGCAGTT
GAAGCTCAATTTTGTTTCCATTCAGGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATCGTTGTGAT
TCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTTCCTCAGGG
AGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCCGTTGGTGA
GTTTGTGTTGTCGATTTCGGACCATACGGTTAAAGGGTTTCTTAGGCACTAATTTCTCACTACAATTAATGGATT
CGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAGGTCGTCGAAAGTGAGCATTCTTCAGAATATGTTT
GCAGTTGGCCGGGCTTATAGCTATATCCCAATAGATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAAT
GATTTCACTATCACCTCAAACGTTACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAAT
GGAGGAGAATCACCCTATACGGTCGTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGAC
GGCAACAACGCTGTGGTCTATAGTAATCGTGCTGACCCAGACACTACACTTTTCGGTAAGTATTGACTTAACTCG
GTCCGAATTTTTTGTCTTATTAACTCTATTATTTTCTGCCGCAGCCGGCGTCGTTGACAAGTAAGTCCTCCACCC
TCTCTGAATCCAAAAGATCCTCAATTACATTGCCTTTCTTTCGTTAGAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGTGAGGAATACCGCTGTTGTCGGACACAGTTAGGTTTATTGAAATTTTTTGCAACTCCA
GGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTCGATGACGCGGAAAAA
GCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTCTCGGTGGCCGGGGTA
CTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTAAAGCCAGACATTGAG
CCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATGGCTTCGAGCCCCAAC
CACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATAGAACCCTTCAGCGAT
GATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGTGGTACAGATCAACGG
GGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGAGAAGCTGCACAAACA
ACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGACTGGCCGGTTCGTTCG
GCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATTATATATCAGCATCAG
GATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAAAATTCTGGAGGTGAA
AGAAGTAGACCAGAGGGAAGTTGAGCTGGTGGTTAATTGAGTTACGTTCAGGGTGGGACACATGTTTTTTGTATT
GTTTAGTTATGAATTTGACTTGACCATCTTCATTCGGACATTGCTCATATTTTAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail