Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026520
Gene name
Locationscaffold_11:1257807..1259740
Strand+
Gene length (bp)1933
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 269 291 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026520
MSSSLVLRLLFGASIFALHAAGQNSQLRFNWKFENDATPQRVPICQDFPIVVIPDPKNTTAGNFIGTPPYYMMSF
PQGGQPITQLIGNTNDTLSWTPKHPVGTNFSLQLMDSDGFTGGDGGLIYQVVENPEGQDCAAPTPPNDFTITSNV
TDGGRVETCHFWRLNINGGESPYTVVLNAVNSPVITNISLSDGNNAVVYSNRADPDTTLFAGVVDKTGRWATGTQ
YISTFGSIDYACIGFRTIVTTQKELDDAEKAREDSQRSKKRTAIIVGVVVSVAGVLFIAGAIAFWIHRRRRLESL
KPDIEPRKFMDSGPSGQVLSVTQFMASSPNHTPSSGKTAFSPIGSLPYSIEPFSDDRRDSTADQSQPHFHLTSSS
GTDQRGGPSFAQFPMSSVRRSGKAREAAQTTLAHHDRSQMLSSSARLLPDWPVRSASLQPPHHDSMSTSAMESEI
IYQHQDAGQVVRELPPPYIPPHLQENSGVTFR*
Coding >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATC
GTTGTGATTCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTT
CCTCAGGGAGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCC
GTTGGCACTAATTTCTCACTACAATTAATGGATTCGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAG
GTCGTCGAAAATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAATGATTTCACTATCACCTCAAACGTT
ACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAATGGAGGAGAATCACCCTATACGGTC
GTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGACGGCAACAACGCTGTGGTCTATAGT
AATCGTGCTGACCCAGACACTACACTTTTCGCCGGCGTCGTTGACAAAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTC
GATGACGCGGAAAAAGCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTC
TCGGTGGCCGGGGTACTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTA
AAGCCAGACATTGAGCCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATG
GCTTCGAGCCCCAACCACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATA
GAACCCTTCAGCGATGATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGT
GGTACAGATCAACGGGGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGA
GAAGCTGCACAAACAACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGAC
TGGCCGGTTCGTTCGGCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATT
ATATATCAGCATCAGGATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAA
AATTCTGGAGTTACGTTCAGGTAA
Transcript >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATC
GTTGTGATTCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTT
CCTCAGGGAGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCC
GTTGGCACTAATTTCTCACTACAATTAATGGATTCGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAG
GTCGTCGAAAATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAATGATTTCACTATCACCTCAAACGTT
ACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAATGGAGGAGAATCACCCTATACGGTC
GTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGACGGCAACAACGCTGTGGTCTATAGT
AATCGTGCTGACCCAGACACTACACTTTTCGCCGGCGTCGTTGACAAAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTC
GATGACGCGGAAAAAGCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTC
TCGGTGGCCGGGGTACTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTA
AAGCCAGACATTGAGCCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATG
GCTTCGAGCCCCAACCACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATA
GAACCCTTCAGCGATGATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGT
GGTACAGATCAACGGGGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGA
GAAGCTGCACAAACAACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGAC
TGGCCGGTTCGTTCGGCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATT
ATATATCAGCATCAGGATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAA
AATTCTGGAGTTACGTTCAGGTAA
Gene >AgabiH97|026520
ATGTCATCGTCGCTGGTTTTACGACTTTTATTCGGCGCTTCCATATTCGCCCTCCATGCAGCGGGCCAAAATTCT
CAACTGAGATTTAATTGGAAATTTGAAAATGATGTAAGTATAGAGCGTGGCCTTTTCTCTCCCTCTCTCGCAGTT
GAAGCTCAATTTTGTTTCCATTCAGGCCACACCGCAGAGAGTACCAATATGTCAGGACTTTCCTATCGTTGTGAT
TCCCGATCCCAAAAATACGACTGCTGGCAATTTCATTGGTACTCCACCGTATTATATGATGTCGTTTCCTCAGGG
AGGTCAACCTATAACACAACTTATCGGGAATACCAATGATACGCTGTCATGGACTCCAAAGCACCCCGTTGGTGA
GTTTGTGTTGTCGATTTCGGACCATACGGTTAAAGGGTTTCTTAGGCACTAATTTCTCACTACAATTAATGGATT
CGGATGGGTTCACAGGAGGAGATGGAGGGCTGATATACCAGGTCGTCGAAAGTGAGCATTCTTCAGAATATGTTT
GCAGTTGGCCGGGCTTATAGCTATATCCCAATAGATCCTGAAGGTCAAGACTGCGCAGCACCCACACCCCCTAAT
GATTTCACTATCACCTCAAACGTTACTGATGGTGGTAGAGTCGAGACTTGTCATTTTTGGAGACTGAACATTAAT
GGAGGAGAATCACCCTATACGGTCGTGCTGAATGCTGTGAATTCTCCTGTCATAACGAATATCTCTCTATCGGAC
GGCAACAACGCTGTGGTCTATAGTAATCGTGCTGACCCAGACACTACACTTTTCGGTAAGTATTGACTTAACTCG
GTCCGAATTTTTTGTCTTATTAACTCTATTATTTTCTGCCGCAGCCGGCGTCGTTGACAAGTAAGTCCTCCACCC
TCTCTGAATCCAAAAGATCCTCAATTACATTGCCTTTCTTTCGTTAGAACTGGGCGATGGGCTACAGGGACGCAA
TACATTTCGACTTTTGGTGAGGAATACCGCTGTTGTCGGACACAGTTAGGTTTATTGAAATTTTTTGCAACTCCA
GGCTCAATAGACTATGCTTGCATCGGTTTTCGTACCATCGTCACCACCCAAAAGGAGCTCGATGACGCGGAAAAA
GCACGCGAAGATTCTCAAAGATCCAAGAAACGCACTGCCATTATCGTCGGCGTTGTTGTCTCGGTGGCCGGGGTA
CTCTTTATCGCTGGTGCAATTGCATTCTGGATACATAGGCGTCGTAGGCTTGAGAGCTTAAAGCCAGACATTGAG
CCACGAAAATTCATGGACTCGGGGCCTAGTGGGCAAGTCCTCTCCGTCACGCAGTTCATGGCTTCGAGCCCCAAC
CACACGCCCTCTTCCGGAAAGACCGCATTTTCCCCGATAGGCTCTCTCCCTTACTCTATAGAACCCTTCAGCGAT
GATAGAAGAGATTCTACCGCTGATCAGTCTCAACCTCACTTCCACCTGACGTCCAGCAGTGGTACAGATCAACGG
GGTGGGCCAAGTTTCGCTCAATTCCCCATGTCCTCGGTTAGGCGCTCAGGGAAGGCACGAGAAGCTGCACAAACA
ACACTTGCCCATCATGATCGGAGCCAAATGTTGTCATCTTCAGCAAGACTTCTTCCAGACTGGCCGGTTCGTTCG
GCCTCATTGCAACCACCACACCATGATTCAATGAGCACTTCCGCTATGGAAAGCGAGATTATATATCAGCATCAG
GATGCTGGACAAGTCGTTCGTGAACTTCCACCTCCATATATTCCGCCTCACTTGCAGGAAAATTCTGGAGGTGAA
AGAAGTAGACCAGAGGGAAGTTGAGCTGGTGGTTAATTGAGTTACGTTCAGGGTGGGACACATGTTTTTTGTATT
GTTTAGTTATGAATTTGACTTGACCATCTTCATTCGGACATTGCTCATATTTTAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail