Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026420
Gene name
Locationscaffold_11:1231032..1234790
Strand+
Gene length (bp)3758
Transcript length (bp)3213
Coding sequence length (bp)3213
Protein length (aa) 1071

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05693 Glycogen_syn Glycogen synthase 0.0E+00 302 902
PF01940 DUF92 Integral membrane protein DUF92 2.0E-69 8 270
PF08323 Glyco_transf_5 Starch synthase catalytic domain 5.0E-06 303 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23337|GYS1_YEAST Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY1 PE=1 SV=3 293 974 0.0E+00
sp|Q55GH4|GYS_DICDI Glycogen [starch] synthase OS=Dictyostelium discoideum GN=glcS PE=3 SV=1 294 892 0.0E+00
sp|P54840|GYS2_HUMAN Glycogen [starch] synthase, liver OS=Homo sapiens GN=GYS2 PE=1 SV=2 304 897 0.0E+00
sp|Q9U2D9|GYS_CAEEL Glycogen [starch] synthase OS=Caenorhabditis elegans GN=gsy-1 PE=1 SV=1 300 895 0.0E+00
sp|Q8VCB3|GYS2_MOUSE Glycogen [starch] synthase, liver OS=Mus musculus GN=Gys2 PE=1 SV=2 295 897 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23337|GYS1_YEAST Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY1 PE=1 SV=3 293 974 0.0E+00
sp|Q55GH4|GYS_DICDI Glycogen [starch] synthase OS=Dictyostelium discoideum GN=glcS PE=3 SV=1 294 892 0.0E+00
sp|P54840|GYS2_HUMAN Glycogen [starch] synthase, liver OS=Homo sapiens GN=GYS2 PE=1 SV=2 304 897 0.0E+00
sp|Q9U2D9|GYS_CAEEL Glycogen [starch] synthase OS=Caenorhabditis elegans GN=gsy-1 PE=1 SV=1 300 895 0.0E+00
sp|Q8VCB3|GYS2_MOUSE Glycogen [starch] synthase, liver OS=Mus musculus GN=Gys2 PE=1 SV=2 295 897 0.0E+00
sp|P17625|GYS2_RAT Glycogen [starch] synthase, liver OS=Rattus norvegicus GN=Gys2 PE=1 SV=2 288 897 0.0E+00
sp|Q9VFC8|GYS_DROME Glycogen [starch] synthase OS=Drosophila melanogaster GN=GlyS PE=1 SV=2 301 894 0.0E+00
sp|Q5R9H0|GYS1_PONAB Glycogen [starch] synthase, muscle OS=Pongo abelii GN=GYS1 PE=2 SV=1 290 906 0.0E+00
sp|Q8MJ26|GYS1_MACMU Glycogen [starch] synthase, muscle OS=Macaca mulatta GN=GYS1 PE=2 SV=1 290 906 0.0E+00
sp|P13807|GYS1_HUMAN Glycogen [starch] synthase, muscle OS=Homo sapiens GN=GYS1 PE=1 SV=2 290 906 0.0E+00
sp|A7MB78|GYS1_BOVIN Glycogen [starch] synthase, muscle OS=Bos taurus GN=GYS1 PE=2 SV=1 290 896 0.0E+00
sp|A2RRU1|GYS1_RAT Glycogen [starch] synthase, muscle OS=Rattus norvegicus GN=Gys1 PE=1 SV=1 290 896 0.0E+00
sp|Q9Z1E4|GYS1_MOUSE Glycogen [starch] synthase, muscle OS=Mus musculus GN=Gys1 PE=1 SV=2 290 896 0.0E+00
sp|P13834|GYS1_RABIT Glycogen [starch] synthase, muscle OS=Oryctolagus cuniculus GN=GYS1 PE=1 SV=4 290 1057 0.0E+00
sp|P27472|GYS2_YEAST Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSY2 PE=1 SV=3 293 974 0.0E+00
sp|O93869|GYS_NEUCR Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gsy-1 PE=2 SV=2 285 984 0.0E+00
sp|Q5RF73|TMM19_PONAB Transmembrane protein 19 OS=Pongo abelii GN=TMEM19 PE=2 SV=1 6 271 1.0E-35
sp|Q96HH6|TMM19_HUMAN Transmembrane protein 19 OS=Homo sapiens GN=TMEM19 PE=1 SV=1 6 271 1.0E-34
sp|Q0P4L9|TMM19_XENTR Transmembrane protein 19 OS=Xenopus tropicalis GN=tmem19 PE=2 SV=1 3 271 5.0E-33
sp|Q6IR76|TMM19_XENLA Transmembrane protein 19 OS=Xenopus laevis GN=tmem19 PE=2 SV=1 3 271 3.0E-30
sp|Q6P726|TMM19_RAT Transmembrane protein 19 OS=Rattus norvegicus GN=Tmem19 PE=2 SV=2 12 271 8.0E-29
sp|Q91W52|TMM19_MOUSE Transmembrane protein 19 OS=Mus musculus GN=Tmem19 PE=1 SV=1 3 271 8.0E-28
sp|Q58343|Y933_METJA Uncharacterized membrane protein MJ0933 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0933 PE=3 SV=1 132 276 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004373 glycogen (starch) synthase activity Yes
GO:0005978 glycogen biosynthetic process Yes
GO:0008150 biological_process No
GO:0046527 glucosyltransferase activity No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0008152 metabolic process No
GO:0006073 cellular glucan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0005976 polysaccharide metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0005977 glycogen metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0044264 cellular polysaccharide metabolic process No
GO:0009250 glucan biosynthetic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0031224 intrinsic component of membrane No
GO:0044260 cellular macromolecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016758 hexosyltransferase activity No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0009987 cellular process No
GO:0044042 glucan metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0006112 energy reserve metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0000271 polysaccharide biosynthetic process No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 77 99 22
3 175 197 22
4 209 231 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026420
MQVVPLVLALLLSLHGLRKKSLSPSGALTAFCVGYGTLSGGLWVFGITLIGFYLIGSRATKYGKQRKARLEEGYQ
EAGYRSGWQVLCNSVCGVAAAVMWNAMFGVEYDSSKWCPLDREVGNGWSRMLLFVALGHFACCLGDTLASELGIL
SAGQPRLVTTFERVPPGTNGGMSVGGTLASLLGGAAVGVLMASTLVVENVRCREAWSSVTLSLIVGGALAGFLGS
LIDSLIGATLQQTRYSQGRVSTEGEVISGLNVLTNNQVNLVSSVVVRNGIINFFFTLYYLAMAAESKRDVRQPVL
FECAWEVANKVGGIYTVIKTKVPVSVSEFGDRYCLIGPLSYKTAPMEVEPEEPTDPHLAATLQSMQAQGVKALYG
RWLIEGNPQVLLFDTSSMYPRLDEWKADLWNLAGIPSPPNDHETNETIVFGYLVAWFLGDYVSRQLTTAIVAHFH
EWQAGLAIPLCRKRHIDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVF
TTVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHATAKAKINEFIRGHFYGHYDFDLDNTIYLFTAG
RYEYRNKGVDMFIESLARLNYQLQKAGSTVTVVAFIIMPAATHSYTIDALKGQAVTKQLRDTVTEIQNRIGQRLF
DRAARFTGDMKSIPTADDLISEEDQILLKRRIFALKRNSLPPVTTHNMADDPNDPILNQIRRVKLFNNAHDRVKI
IFHPDFLNSNNPILALDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIERPEEEGC
YIVDRRMQSVEDSVNQLADYLYAFTNKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQLGLRRAYPDAFEGGE
GGVGGGLGLGENGEDMWDDGFSGGEDVGGGGPGGHGGHGGGGRRVGMYASAGSVPASPRMRGAITPGDIGTLTED
MQGLGTSDYRGYGWADHVDEDDTYPFPLAMKVRSRSGSVRSRSGASTPGGGGVGAFKSLSEGDLRKANAALKLSQ
VNGEDEDTGGQGKNGGGSGN*
Coding >AgabiH97|026420
ATGCAAGTCGTACCTCTCGTACTCGCGTTGCTCTTGAGCCTTCACGGTTTACGCAAAAAATCACTTTCACCCAGT
GGTGCTCTGACAGCCTTTTGTGTGGGTTATGGTACCTTGTCTGGAGGACTATGGGTATTTGGTATTACACTCATC
GGATTCTATCTCATCGGAAGTCGGGCCACGAAATATGGAAAGCAGCGCAAAGCGAGATTGGAGGAGGGGTATCAA
GAGGCGGGATATCGGAGTGGGTGGCAGGTGTTGTGCAATAGCGTGTGTGGGGTGGCGGCGGCGGTGATGTGGAAT
GCCATGTTTGGGGTGGAGTATGACAGTAGTAAGTGGTGTCCGCTGGACAGAGAGGTTGGCAATGGATGGAGTCGA
ATGCTGCTATTTGTGGCTCTTGGCCATTTTGCATGCTGTTTGGGGGACACGTTGGCGTCTGAGCTGGGTATTTTG
TCTGCTGGGCAGCCGAGGCTGGTGACGACGTTTGAGCGAGTTCCGCCTGGGACCAACGGAGGAATGTCGGTGGGC
GGCACGCTTGCTTCCCTTTTGGGGGGTGCGGCGGTCGGGGTCCTGATGGCGTCCACTCTGGTCGTTGAGAACGTG
CGGTGCCGAGAAGCGTGGAGCTCTGTGACGCTCTCGTTGATCGTGGGCGGTGCCTTGGCCGGCTTCTTGGGCAGC
CTGATTGATTCGTTGATCGGCGCGACCCTTCAGCAGACCCGCTACTCTCAAGGCCGTGTGTCGACCGAGGGCGAG
GTGATTAGCGGGTTGAATGTGTTGACGAACAACCAGGTGAATCTGGTGTCGTCGGTCGTAGTGAGAAATGGGATA
ATTAATTTTTTTTTTACGTTGTATTATCTTGCCATGGCTGCTGAAAGCAAGCGCGATGTCCGACAGCCCGTCCTG
TTTGAATGTGCGTGGGAAGTCGCGAACAAGGTCGGGGGCATCTACACGGTGATCAAGACCAAAGTGCCCGTCTCC
GTCTCCGAGTTTGGCGACCGATACTGCCTCATCGGCCCGCTCTCCTACAAGACCGCGCCGATGGAGGTCGAGCCA
GAGGAGCCCACTGACCCCCACCTCGCTGCCACTCTCCAGTCCATGCAGGCCCAGGGCGTCAAGGCGCTCTACGGT
CGCTGGCTCATCGAGGGTAACCCCCAGGTCCTTCTCTTTGATACCAGCAGCATGTACCCCCGCCTCGACGAGTGG
AAGGCCGACCTCTGGAACCTCGCTGGCATCCCCAGCCCTCCCAACGACCACGAGACAAACGAGACCATCGTCTTT
GGCTATCTCGTCGCTTGGTTCCTGGGCGATTACGTCTCCCGCCAACTGACCACCGCCATCGTCGCCCACTTTCAC
GAATGGCAAGCTGGCCTCGCCATCCCCCTCTGTCGCAAACGTCATATCGATGTCACCACGGTGTTCACCACCCAT
GCCACCCTCTTGGGCCGATATCTCTGTGCTGGCTCTGTCGACTTTTACAACAATCTCCAATACTTTGACGTCGAC
CACGAGGCCGGAAAACGCGGTATCTACCACAGATACTGCATCGAACGTTCTGCTGCCCACTGCGCCGACGTCTTT
ACCACCGTTTCTCACATCACAGCCTACGAAAGCGAGCATCTCCTCAAACGCAAACCCGACGGAGTCCTTCCCAAC
GGTCTCAACGTCGTCAAATTTCAAGCCATGCATGAATTTCAAAATCTTCATGCCACCGCCAAGGCCAAGATCAAC
GAGTTTATCCGTGGTCATTTCTATGGCCACTACGACTTTGATCTTGATAATACCATCTACTTGTTTACTGCCGGT
CGTTACGAGTACAGGAACAAGGGCGTGGACATGTTTATCGAATCTCTCGCTCGCCTCAACTATCAGTTGCAGAAA
GCAGGCTCAACAGTCACTGTCGTCGCCTTTATCATCATGCCCGCCGCGACCCACTCTTATACCATCGATGCTCTC
AAAGGACAAGCCGTCACAAAGCAGCTCCGCGATACAGTCACTGAAATCCAAAATCGTATCGGTCAACGTTTGTTT
GACCGTGCCGCCCGTTTCACTGGCGACATGAAATCCATTCCAACTGCAGATGATTTGATTTCAGAAGAAGATCAA
ATTCTACTCAAGCGACGTATCTTTGCGCTTAAGCGAAACTCACTTCCGCCTGTCACGACGCACAACATGGCTGAT
GATCCCAACGATCCGATTTTAAACCAGATCCGACGTGTCAAGTTGTTCAACAATGCTCATGATCGTGTTAAAATT
ATCTTTCATCCTGATTTTCTCAATAGTAATAATCCGATTTTGGCATTGGATTATGAAGAGTTTGTGAGGGGATGT
CATTTGGGTGTGTTTCCGAGTTATTATGAACCGTGGGGGTATACACCTGCGGAATGCACTGTTATGGGAATTCCG
AGTATTACGACCAATCTTTCTGGATTTGGGTGTTTTATGCAAGATCTCATTGAACGTCCTGAAGAAGAAGGCTGT
TACATTGTCGATCGTCGAATGCAATCCGTCGAAGATTCAGTTAACCAATTAGCTGATTATCTGTATGCCTTTACC
AACAAAACTCGGCGTCAAAGGATCAATCAACGTAATCGAGTCGAACGGTTGTCGCCGTTGTTGGATTGGAAGAAT
TTGGGGATTGAGTATTCAAAGGCCAGGCAATTGGGGTTGAGGAGGGCTTATCCGGATGCGTTTGAGGGTGGGGAG
GGTGGTGTGGGTGGTGGGTTGGGGTTGGGAGAGAATGGAGAGGATATGTGGGATGATGGGTTTAGTGGTGGAGAG
GATGTGGGTGGTGGGGGGCCGGGGGGACATGGGGGACATGGAGGTGGGGGGAGGAGGGTGGGTATGTATGCTAGT
GCGGGGAGTGTACCTGCTAGTCCGAGGATGAGAGGTGCGATTACCCCAGGTGATATTGGGACTTTGACGGAGGAT
ATGCAAGGTCTGGGGACGAGTGATTATAGAGGGTATGGATGGGCCGATCACGTAGACGAAGATGATACCTATCCC
TTCCCCCTCGCAATGAAAGTCCGTTCAAGATCAGGTTCGGTGAGAAGTCGAAGTGGGGCTAGTACACCTGGTGGG
GGAGGGGTGGGAGCGTTTAAGAGTTTGAGTGAGGGGGATTTGAGAAAGGCGAATGCGGCGTTGAAGTTGAGTCAG
GTGAATGGGGAGGATGAGGATACGGGTGGGCAGGGGAAGAATGGGGGTGGGAGTGGGAATTGA
Transcript >AgabiH97|026420
ATGCAAGTCGTACCTCTCGTACTCGCGTTGCTCTTGAGCCTTCACGGTTTACGCAAAAAATCACTTTCACCCAGT
GGTGCTCTGACAGCCTTTTGTGTGGGTTATGGTACCTTGTCTGGAGGACTATGGGTATTTGGTATTACACTCATC
GGATTCTATCTCATCGGAAGTCGGGCCACGAAATATGGAAAGCAGCGCAAAGCGAGATTGGAGGAGGGGTATCAA
GAGGCGGGATATCGGAGTGGGTGGCAGGTGTTGTGCAATAGCGTGTGTGGGGTGGCGGCGGCGGTGATGTGGAAT
GCCATGTTTGGGGTGGAGTATGACAGTAGTAAGTGGTGTCCGCTGGACAGAGAGGTTGGCAATGGATGGAGTCGA
ATGCTGCTATTTGTGGCTCTTGGCCATTTTGCATGCTGTTTGGGGGACACGTTGGCGTCTGAGCTGGGTATTTTG
TCTGCTGGGCAGCCGAGGCTGGTGACGACGTTTGAGCGAGTTCCGCCTGGGACCAACGGAGGAATGTCGGTGGGC
GGCACGCTTGCTTCCCTTTTGGGGGGTGCGGCGGTCGGGGTCCTGATGGCGTCCACTCTGGTCGTTGAGAACGTG
CGGTGCCGAGAAGCGTGGAGCTCTGTGACGCTCTCGTTGATCGTGGGCGGTGCCTTGGCCGGCTTCTTGGGCAGC
CTGATTGATTCGTTGATCGGCGCGACCCTTCAGCAGACCCGCTACTCTCAAGGCCGTGTGTCGACCGAGGGCGAG
GTGATTAGCGGGTTGAATGTGTTGACGAACAACCAGGTGAATCTGGTGTCGTCGGTCGTAGTGAGAAATGGGATA
ATTAATTTTTTTTTTACGTTGTATTATCTTGCCATGGCTGCTGAAAGCAAGCGCGATGTCCGACAGCCCGTCCTG
TTTGAATGTGCGTGGGAAGTCGCGAACAAGGTCGGGGGCATCTACACGGTGATCAAGACCAAAGTGCCCGTCTCC
GTCTCCGAGTTTGGCGACCGATACTGCCTCATCGGCCCGCTCTCCTACAAGACCGCGCCGATGGAGGTCGAGCCA
GAGGAGCCCACTGACCCCCACCTCGCTGCCACTCTCCAGTCCATGCAGGCCCAGGGCGTCAAGGCGCTCTACGGT
CGCTGGCTCATCGAGGGTAACCCCCAGGTCCTTCTCTTTGATACCAGCAGCATGTACCCCCGCCTCGACGAGTGG
AAGGCCGACCTCTGGAACCTCGCTGGCATCCCCAGCCCTCCCAACGACCACGAGACAAACGAGACCATCGTCTTT
GGCTATCTCGTCGCTTGGTTCCTGGGCGATTACGTCTCCCGCCAACTGACCACCGCCATCGTCGCCCACTTTCAC
GAATGGCAAGCTGGCCTCGCCATCCCCCTCTGTCGCAAACGTCATATCGATGTCACCACGGTGTTCACCACCCAT
GCCACCCTCTTGGGCCGATATCTCTGTGCTGGCTCTGTCGACTTTTACAACAATCTCCAATACTTTGACGTCGAC
CACGAGGCCGGAAAACGCGGTATCTACCACAGATACTGCATCGAACGTTCTGCTGCCCACTGCGCCGACGTCTTT
ACCACCGTTTCTCACATCACAGCCTACGAAAGCGAGCATCTCCTCAAACGCAAACCCGACGGAGTCCTTCCCAAC
GGTCTCAACGTCGTCAAATTTCAAGCCATGCATGAATTTCAAAATCTTCATGCCACCGCCAAGGCCAAGATCAAC
GAGTTTATCCGTGGTCATTTCTATGGCCACTACGACTTTGATCTTGATAATACCATCTACTTGTTTACTGCCGGT
CGTTACGAGTACAGGAACAAGGGCGTGGACATGTTTATCGAATCTCTCGCTCGCCTCAACTATCAGTTGCAGAAA
GCAGGCTCAACAGTCACTGTCGTCGCCTTTATCATCATGCCCGCCGCGACCCACTCTTATACCATCGATGCTCTC
AAAGGACAAGCCGTCACAAAGCAGCTCCGCGATACAGTCACTGAAATCCAAAATCGTATCGGTCAACGTTTGTTT
GACCGTGCCGCCCGTTTCACTGGCGACATGAAATCCATTCCAACTGCAGATGATTTGATTTCAGAAGAAGATCAA
ATTCTACTCAAGCGACGTATCTTTGCGCTTAAGCGAAACTCACTTCCGCCTGTCACGACGCACAACATGGCTGAT
GATCCCAACGATCCGATTTTAAACCAGATCCGACGTGTCAAGTTGTTCAACAATGCTCATGATCGTGTTAAAATT
ATCTTTCATCCTGATTTTCTCAATAGTAATAATCCGATTTTGGCATTGGATTATGAAGAGTTTGTGAGGGGATGT
CATTTGGGTGTGTTTCCGAGTTATTATGAACCGTGGGGGTATACACCTGCGGAATGCACTGTTATGGGAATTCCG
AGTATTACGACCAATCTTTCTGGATTTGGGTGTTTTATGCAAGATCTCATTGAACGTCCTGAAGAAGAAGGCTGT
TACATTGTCGATCGTCGAATGCAATCCGTCGAAGATTCAGTTAACCAATTAGCTGATTATCTGTATGCCTTTACC
AACAAAACTCGGCGTCAAAGGATCAATCAACGTAATCGAGTCGAACGGTTGTCGCCGTTGTTGGATTGGAAGAAT
TTGGGGATTGAGTATTCAAAGGCCAGGCAATTGGGGTTGAGGAGGGCTTATCCGGATGCGTTTGAGGGTGGGGAG
GGTGGTGTGGGTGGTGGGTTGGGGTTGGGAGAGAATGGAGAGGATATGTGGGATGATGGGTTTAGTGGTGGAGAG
GATGTGGGTGGTGGGGGGCCGGGGGGACATGGGGGACATGGAGGTGGGGGGAGGAGGGTGGGTATGTATGCTAGT
GCGGGGAGTGTACCTGCTAGTCCGAGGATGAGAGGTGCGATTACCCCAGGTGATATTGGGACTTTGACGGAGGAT
ATGCAAGGTCTGGGGACGAGTGATTATAGAGGGTATGGATGGGCCGATCACGTAGACGAAGATGATACCTATCCC
TTCCCCCTCGCAATGAAAGTCCGTTCAAGATCAGGTTCGGTGAGAAGTCGAAGTGGGGCTAGTACACCTGGTGGG
GGAGGGGTGGGAGCGTTTAAGAGTTTGAGTGAGGGGGATTTGAGAAAGGCGAATGCGGCGTTGAAGTTGAGTCAG
GTGAATGGGGAGGATGAGGATACGGGTGGGCAGGGGAAGAATGGGGGTGGGAGTGGGAATTGA
Gene >AgabiH97|026420
ATGCAAGTCGTACCTCTCGTACTCGCGTTGCTCTTGAGCCTTCACGGTTTACGCAAAAAATCACTTTCACCCAGT
GGTGCTCTGACAGCCTTTTGTGTGGGTTATGGTACCTTGTCTGGAGGACTATGGGTATTTGGTATTACACTCATC
GGATTCTATCTCATCGGAAGTCGGGCCACGAAATGTAAGTTTTGAGTTTTGAATTTTTGAGCAAGTATGAATGTA
TATACACAGATGGAAAGCAGCGCAAAGCGAGATTGGAGGAGGGGTATCAAGAGGCGGGATATCGGAGTGGGTGGC
AGGTGTTGTGCAATAGCGTGTGTGGGGTGGCGGCGGCGGTGATGTGGAATGCCATGTTTGGGGTGGAGTATGACA
GTAGTAAGTGGTGTCCGCTGGACAGAGAGGTTGGCAATGGATGGAGTCGAATGCTGCTATTTGTGGCTCTTGGGT
GAGTAATACCACTCATCATTCATGATGCTTAACTGACGGGTCTACAGCCATTTTGCATGCTGTTTGGGGGACACG
TTGGCGTCTGAGCTGGGTATTTTGTCTGCTGGGCAGCCGAGGCTGGTGACGACGTTTGAGCGAGTTCCGCCTGGG
ACCAACGGAGGAATGTCGGTGGGCGGCACGCTTGCTTCCCTTTTGGGGGGTGCGGCGGTCGGGGTCCTGATGGCG
TCCACTCTGGTCGTTGAGAACGTGCGGTGCCGAGAAGCGTGGAGCTCTGTGACGCTCTCGTTGATCGTGGGCGGT
GCCTTGGCCGGCTTCTTGGGCAGCCTGGTGCGTCACGCTGTCCGCCTTGATGTAAAACTCACAAAAGACCATAGA
TTGATTCGTTGATCGGCGCGACCCTTCAGCAGACCCGCTACTCTCAAGGCCGTGTGTCGACCGAGGGCGAGGTGA
TTAGCGGGTTGAATGTGTTGACGAACAACCAGGTGCGTAATAAATCATGCGTGCACGCTGTTGCTGACGATGAGC
AGGTGAATCTGGTGTCGTCGGTGATTACGTCGGTGGTATCTGGGGTCGTGTCACGGTCACGGTGACGTCAGGTCG
TAGTGAGAAATGGGATAATTAATTTTTTTTTTACGTTGTATTATCTTGCCATGGCTGCTGAAAGCAAGCGCGATG
TCCGACAGCCCGTCCTGTTTGAATGTGCGTGGGAAGTCGCGAACAAGGTCGGGGGCATCTACACGGTGATCAAGA
CCAAAGTGCCCGTCTCCGTCTCCGAGTTTGGCGACCGATACTGCCTCATCGGCCCGCTCTCCTACAAGACCGCGC
CGATGGAGGTCGAGCCAGAGGAGCCCACTGACCCCCACCTCGCTGCCACTCTCCAGTCCATGCAGGCCCAGGGCG
TCAAGGCGCTCTACGGTCGCTGGCTCATCGAGGGTAACCCCCAGGTCCTTCTCTTTGATACCAGCAGCATGTACC
CCCGCCTCGACGAGTGGAAGGCCGACCTCTGGAACCTCGCTGGCATCCCCAGCCCTCCCAACGACCACGAGACAA
ACGAGACCATCGTCTTTGGCTATCTCGTCGCTTGGTTCCTGGGCGATGTGAGTTTTGCTGTTCTCTACTCTGGTC
TTGTTGATTGATCTTCCCTGCAGTACGTCTCCCGCCAACTGACCACCGCCATCGTCGCCCACTTTCACGAATGGC
AAGCTGGCCTCGCCATCCCCCTCTGTCGCAAACGTCATATCGATGTCACCACGGTGTTCACCACCCATGCCACCC
TCTTGGGCCGATATCTCTGTGCTGGCTCTGTCGACTTTTACAACAATCTCCAATACTTTGACGTCGACCACGAGG
CCGGAAAACGCGGTATCTACCACAGATACTGCATCGAACGTTCTGCTGCCCACTGCGCCGACGTCTTTACCACCG
TTTCTCACATCACAGCCTACGAAAGCGAGCATCTCCTCAAACGCAAACCCGACGGAGTCCTTCCCAACGGTCTCA
ACGTCGTCAAATTTCAAGCCATGCATGAATTTCAAAATCTTCATGCCACCGCCAAGGCCAAGATCAACGAGTTTA
TCCGTGGTCATTTCTATGGCCACTACGACTTTGATCTTGATAATACCATCTACTTGTTTACTGCCGGTCGTTACG
AGTACAGGAACAAGGGCGTGGACATGTTTATCGAATCTCTCGCTCGCCTCAACTATCAGTTGCAGAAAGCAGGCT
CAACAGTCACTGTCGTCGCCTTTATCATCATGCCCGCCGCGACCCACTCTTATACCATCGATGCTCTCAAAGGAC
AAGCCGTCACAAAGCAGCTCCGCGATACAGTCACTGAAATCCAAAATCGTATCGGTCAACGTTTGTTTGACCGTG
CCGCCCGTTTCACTGGGTGTGTGTCCTTTTCTTGTGTCCTTGTGCAGCAAACTCATCTTACTCTTTCAAGCGACA
TGAAATCCATTCCAACTGCAGATGATTTGATTTCAGAAGAAGATCAAATTCTACTCAAGCGACGTATCTTTGCGC
TTAAGCGAAACTCACTTCCGCCTGTCACGACGCACAACATGGCTGATGATCCCAACGATCCGATTTTAAACCAGA
TCCGACGTGTCAAGTTGTTCAACAATGCTCATGATCGTGTTAAAATTATCTTTCATCCTGATTTTCTCAATAGTA
ATAATCCGATTTTGGCATTGGATTATGAAGAGTTTGTGAGGGGATGTCATTTGGGTGTGTTTCCGAGTTATTATG
AACCGTGGGGGTATACACCTGCGGAATGCACTGTTGTATGTGTATTTTCCTATTTTGCTGTGATGCGATTTAATG
ATTTTTTTTTTTAGATGGGAATTCCGAGTATTACGACCAATCTTTCTGGATTTGGGTGTTTTATGCAAGATCTCA
TTGAACGTCCTGAAGAAGAAGGCTGTTACATTGTCGATCGTCGAATGCAATCCGTCGAAGATTCAGTTAACCAAT
TAGCTGATTATCTGTATGCCTTTACCAACAAAACTCGGCGTCAAAGGATCAATCAACGTAATCGAGTCGAACGGT
TGTCGCCGTTGTTGGATTGGAAGAATTTGGGGATTGAGTATTCAAAGGCCAGGCAATTGGGGTTGAGGAGGGCTT
ATCCGGATGCGTTTGAGGGTGGGGAGGGTGGTGTGGGTGGTGGGTTGGGGTTGGGAGAGAATGGAGAGGATATGT
GGGATGATGGGTTTAGTGGTGGAGAGGATGTGGGTGGTGGGGGGCCGGGGGGACATGGGGGACATGGAGGTGGGG
GGAGGAGGGTGGGTATGTATGCTAGTGCGGGGAGTGTACCTGCTAGTCCGAGGATGAGAGGTGCGATTACCCCAG
GTGATATTGGGACTTTGACGGAGGATGTGAGTTTGGTGGTGGTGTTTTCTGGTTTTTGGCTGATGAGGTTTTTCT
TTTTTTTTTAGATGCAAGGTCTGGGGACGAGTGATTATAGAGGGTATGGATGGGCCGATCACGTAGACGAAGATG
ATACCTATCCCTTGTACGTTTTCTCTCTCTCTCTCTCTCCCCTCATCCTCATCATCACACAACTAACCTCTCCTC
TCCTCTCCTCTTCCTCTCAAAGCCCCCTCGCAATGAAAGTCCGTTCAAGATCAGGTTCGGTGAGAAGTCGAAGTG
GGGCTAGTACACCTGGTGGGGGAGGGGTGGGAGCGTTTAAGAGTTTGAGTGAGGGGGATTTGAGAAAGGCGAATG
CGGCGTTGAAGTTGAGTCAGGTGAATGGGGAGGATGAGGATACGGGTGGGCAGGGGAAGAATGGGGGTGGGAGTG
GGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail