Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|026000
Gene name
Locationscaffold_11:1138850..1140672
Strand-
Gene length (bp)1822
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.0E-16 6 207
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.9E-12 7 166
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 4.9E-08 7 185
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.1E-06 5 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P44094|Y1014_HAEIN Uncharacterized protein HI_1014 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1014 PE=3 SV=1 6 316 1.0E-67
sp|P43939|Y094_HAEIN Uncharacterized protein HI_0094 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0094 PE=4 SV=1 159 214 2.0E-17
sp|Q5HIC2|Y599_STAAC Uncharacterized epimerase/dehydratase SACOL0599 OS=Staphylococcus aureus (strain COL) GN=SACOL0599 PE=3 SV=1 4 199 4.0E-14
sp|Q99W56|Y553_STAAM Uncharacterized epimerase/dehydratase SAV0553 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0553 PE=3 SV=1 4 199 4.0E-14
sp|Q2FJ87|Y538_STAA3 Uncharacterized epimerase/dehydratase SAUSA300_0538 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0538 PE=3 SV=1 4 199 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P44094|Y1014_HAEIN Uncharacterized protein HI_1014 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1014 PE=3 SV=1 6 316 1.0E-67
sp|P43939|Y094_HAEIN Uncharacterized protein HI_0094 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0094 PE=4 SV=1 159 214 2.0E-17
sp|Q5HIC2|Y599_STAAC Uncharacterized epimerase/dehydratase SACOL0599 OS=Staphylococcus aureus (strain COL) GN=SACOL0599 PE=3 SV=1 4 199 4.0E-14
sp|Q99W56|Y553_STAAM Uncharacterized epimerase/dehydratase SAV0553 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0553 PE=3 SV=1 4 199 4.0E-14
sp|Q2FJ87|Y538_STAA3 Uncharacterized epimerase/dehydratase SAUSA300_0538 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0538 PE=3 SV=1 4 199 4.0E-14
sp|Q2G0M5|Y535_STAA8 Uncharacterized epimerase/dehydratase SAOUHSC_00535 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00535 PE=3 SV=1 4 199 4.0E-14
sp|Q6GBT4|Y511_STAAS Uncharacterized epimerase/dehydratase SAS0511 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0511 PE=3 SV=1 4 199 4.0E-14
sp|Q7A788|Y511_STAAN Uncharacterized epimerase/dehydratase SA0511 OS=Staphylococcus aureus (strain N315) GN=SA0511 PE=1 SV=1 4 199 4.0E-14
sp|Q7A1Q7|Y508_STAAW Uncharacterized epimerase/dehydratase MW0508 OS=Staphylococcus aureus (strain MW2) GN=MW0508 PE=3 SV=1 4 199 4.0E-14
sp|Q49VA1|Y2164_STAS1 Uncharacterized epimerase/dehydratase SSP2164 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP2164 PE=3 SV=1 4 195 5.0E-14
sp|Q2YSA8|Y504_STAAB Uncharacterized epimerase/dehydratase SAB0504 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0504 PE=3 SV=1 4 199 1.0E-13
sp|Q6GJB5|Y558_STAAR Uncharacterized epimerase/dehydratase SAR0558 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0558 PE=3 SV=1 4 199 1.0E-13
sp|Q8CQ79|Y317_STAES Uncharacterized epimerase/dehydratase SE_0317 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0317 PE=3 SV=1 4 195 1.0E-12
sp|Q5HRJ9|Y194_STAEQ Uncharacterized epimerase/dehydratase SERP0194 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0194 PE=3 SV=1 4 195 1.0E-12
sp|Q4L3L8|Y2450_STAHJ Uncharacterized epimerase/dehydratase SH2450 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2450 PE=3 SV=1 4 320 2.0E-12
sp|Q8MIR0|TDH_PIG L-threonine 3-dehydrogenase, mitochondrial OS=Sus scrofa GN=TDH PE=1 SV=1 76 318 1.0E-06
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 5 159 1.0E-06
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 6 201 2.0E-06
sp|Q2KIR8|TDH_BOVIN L-threonine 3-dehydrogenase, mitochondrial OS=Bos taurus GN=TDH PE=2 SV=1 81 318 2.0E-06
sp|P55579|Y4NG_RHISN Uncharacterized protein y4nG OS=Rhizobium sp. (strain NGR234) GN=NGR_a02350 PE=3 SV=1 3 182 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0016229 steroid dehydrogenase activity No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|026000
MSTETILITGSAGFLGSLLGQKLVENASHPIRLLLTDVAEPNAPPNSQAKTFKVDLTDPGQIRQLFETAFGVPDT
IYCMHGIMSRGAEDNFDLGLKINVDSVVSLLQAAREYGTRASKVIKFVFTSSLAVYGGPLPKIVTPSTIAIPQSA
YGMEKLTCELYINEFTRRGFVDGRICRLPTIVVRPGPPAAATSSFLSAIIREPLSGQRATCPIGNSRDSPELNLA
VWLASPATTIQNLVLIRTIPAHKFLPHTRVVCLPGFTVTIRDMLDALERIAGSQTLELIDFKDDETNRRIVLSWP
ATFDSEYAMGLGLKLDLDGMDRYQGHFAPCNYRVVARPCSVGAYTSFIIQSPIFSRTTQLRMHRLLPNSDNATPF
QERRKESKSQESGSLFTIEFAGMSHRSRRLIIPAGQRFYTPVPHCALLGNSDDYLRNSQMSTEGAASSVYYYFSP
LDHVYVFE*
Coding >AgabiH97|026000
ATGTCCACAGAAACTATCCTGATCACTGGCTCTGCAGGCTTTCTGGGTAGCCTATTGGGCCAAAAGCTAGTCGAG
AATGCCAGCCACCCCATTCGCCTCCTCTTGACCGACGTCGCTGAACCTAATGCTCCTCCGAACTCCCAGGCAAAG
ACTTTCAAAGTGGACTTAACAGATCCTGGTCAAATTCGCCAATTGTTTGAGACTGCCTTCGGCGTTCCGGACACG
ATATACTGCATGCATGGTATTATGTCCCGTGGCGCTGAAGATAACTTTGATCTTGGTCTCAAGATCAACGTCGAC
TCTGTGGTGTCCCTCCTCCAGGCCGCACGAGAATATGGGACTCGGGCGAGTAAAGTGATCAAGTTCGTTTTCACT
TCCTCACTCGCAGTCTATGGTGGCCCACTGCCCAAAATTGTGACACCGTCTACCATAGCCATTCCACAGAGTGCA
TATGGCATGGAAAAGCTCACATGTGAGCTCTATATCAATGAATTCACCCGTCGAGGTTTTGTCGACGGCCGTATT
TGTCGACTCCCGACGATTGTTGTGCGCCCAGGTCCGCCGGCCGCGGCAACTTCATCCTTCCTCTCAGCCATTATC
CGGGAACCATTAAGTGGTCAACGAGCTACATGTCCCATTGGCAACTCGAGAGATTCTCCGGAGTTGAATCTCGCT
GTGTGGCTAGCCTCACCAGCAACGACCATTCAGAATCTTGTTCTAATCCGAACGATTCCAGCCCATAAATTCCTT
CCTCACACACGTGTTGTCTGTTTGCCGGGTTTCACTGTAACGATTCGAGACATGCTTGATGCATTGGAAAGGATT
GCAGGATCTCAAACCCTGGAATTGATTGACTTTAAAGATGATGAAACGAACAGACGTATTGTGTTATCCTGGCCC
GCCACATTTGATAGCGAGTATGCCATGGGACTAGGACTCAAACTTGATTTGGATGGGATGGATCGCTACCAGGGG
CACTTTGCTCCGTGCAATTATCGAGTAGTTGCTAGGCCATGTTCTGTAGGAGCTTATACATCTTTTATTATTCAA
TCACCTATCTTCTCCAGAACAACGCAGTTGCGTATGCATCGCTTACTGCCTAATAGCGATAATGCGACGCCATTC
CAAGAGAGACGGAAAGAATCGAAAAGCCAAGAGTCTGGTAGCTTGTTTACCATAGAATTTGCGGGAATGTCGCAT
CGTTCTAGAAGACTCATCATACCCGCTGGGCAGCGGTTTTACACCCCCGTGCCCCACTGTGCTTTGTTGGGCAAC
TCGGATGACTACCTTCGTAACTCGCAAATGTCGACAGAGGGCGCAGCCTCTTCCGTCTACTATTACTTTTCTCCT
CTGGACCACGTTTACGTTTTTGAGTAG
Transcript >AgabiH97|026000
ATGTCCACAGAAACTATCCTGATCACTGGCTCTGCAGGCTTTCTGGGTAGCCTATTGGGCCAAAAGCTAGTCGAG
AATGCCAGCCACCCCATTCGCCTCCTCTTGACCGACGTCGCTGAACCTAATGCTCCTCCGAACTCCCAGGCAAAG
ACTTTCAAAGTGGACTTAACAGATCCTGGTCAAATTCGCCAATTGTTTGAGACTGCCTTCGGCGTTCCGGACACG
ATATACTGCATGCATGGTATTATGTCCCGTGGCGCTGAAGATAACTTTGATCTTGGTCTCAAGATCAACGTCGAC
TCTGTGGTGTCCCTCCTCCAGGCCGCACGAGAATATGGGACTCGGGCGAGTAAAGTGATCAAGTTCGTTTTCACT
TCCTCACTCGCAGTCTATGGTGGCCCACTGCCCAAAATTGTGACACCGTCTACCATAGCCATTCCACAGAGTGCA
TATGGCATGGAAAAGCTCACATGTGAGCTCTATATCAATGAATTCACCCGTCGAGGTTTTGTCGACGGCCGTATT
TGTCGACTCCCGACGATTGTTGTGCGCCCAGGTCCGCCGGCCGCGGCAACTTCATCCTTCCTCTCAGCCATTATC
CGGGAACCATTAAGTGGTCAACGAGCTACATGTCCCATTGGCAACTCGAGAGATTCTCCGGAGTTGAATCTCGCT
GTGTGGCTAGCCTCACCAGCAACGACCATTCAGAATCTTGTTCTAATCCGAACGATTCCAGCCCATAAATTCCTT
CCTCACACACGTGTTGTCTGTTTGCCGGGTTTCACTGTAACGATTCGAGACATGCTTGATGCATTGGAAAGGATT
GCAGGATCTCAAACCCTGGAATTGATTGACTTTAAAGATGATGAAACGAACAGACGTATTGTGTTATCCTGGCCC
GCCACATTTGATAGCGAGTATGCCATGGGACTAGGACTCAAACTTGATTTGGATGGGATGGATCGCTACCAGGGG
CACTTTGCTCCGTGCAATTATCGAGTAGTTGCTAGGCCATGTTCTGTAGGAGCTTATACATCTTTTATTATTCAA
TCACCTATCTTCTCCAGAACAACGCAGTTGCGTATGCATCGCTTACTGCCTAATAGCGATAATGCGACGCCATTC
CAAGAGAGACGGAAAGAATCGAAAAGCCAAGAGTCTGGTAGCTTGTTTACCATAGAATTTGCGGGAATGTCGCAT
CGTTCTAGAAGACTCATCATACCCGCTGGGCAGCGGTTTTACACCCCCGTGCCCCACTGTGCTTTGTTGGGCAAC
TCGGATGACTACCTTCGTAACTCGCAAATGTCGACAGAGGGCGCAGCCTCTTCCGTCTACTATTACTTTTCTCCT
CTGGACCACGTTTACGTTTTTGAGTAG
Gene >AgabiH97|026000
ATGTCCACAGAAACTATCCTGATCACTGGCTCTGCAGGCTTTCTGGGTAGCCTAGTAAGCATATCTGGCGCTTCA
GACGTCTTCCAGGCACTGATCGTGGTCTGATACTTAGTTGGGCCAAAAGCTAGTCGAGAATGCCAGCCACCCCAT
TCGCCTCCTCTTGACCGACGTCGCTGAACCTAATGCTCCTCCGAACTCCCAGGCAAAGACTTTCAAAGTGGACTT
AACAGATCCTGGTCAAATTCGCCAATTGTTTGAGACTGCCTTCGGCGTTCCGGACACGATATACTGCATGCATGG
TATTATGTCCCGTGGCGCTGAAGATAACTTTGATCTTGGTCTCAAGGTCTCTAATCCCACTTACGCTTAATTCGC
CTTCCTTCTCTCATTCCTGCCTCTCAGATCAACGTCGACTCTGTGGTGTCCCTCCTCCAGGCCGCACGAGAATAT
GGGACTCGGGCGAGTAAAGTGATCAAGTTCGTTTTCACTTCCTCACTCGCAGTCTATGGTGGCCCACTGGTTCGT
CAATAAAGTATCATCTAACTTTGTAGTTCCGCAACTTATTCTGTAACATAGCCCAAAATTGTGACACCGTCTACC
ATAGCCATTCCACAGAGTGCATATGGCATGGAAAAGCTCACATGTGAGCTCTATATCAATGAATTCACCCGTCGA
GGTTTTGTCGACGGCCGTATTTGTCGACTCCCGACGATTGTTGTGCGCCCAGGTCCGCCGGCCGCGGCAACTTCA
TCCTTCCTCTCAGGTAAGTTCTTCACTACACCTCTAACTGACTTCCATAATCAGCTTCTTCTTAGCCATTATCCG
GGAACCATTAAGTGGTCAACGAGCTACATGTCCCATTGGCAACTCGAGAGATTCTCCGGAGTTGAATCTCGCTGT
GTGGCTAGCCTCACCAGCAACGACCATTCAGAATCTTGTTCTAATCCGAACGATTCCAGCCCATAAATTCCTTCC
TCACACACGTGTTGTCTGTTTGCCGGGTTTCACTGTAACGATTCGAGACATGCTTGATGCATTGGAAAGGATTGC
AGGATCTCAAACCCTGGAATTGATTGACTTTAAAGATGATGAAACGAACAGACGTATTGTGTTATCCTGGCCCGC
CACATTTGATAGCGAGTATGCCATGGGACTAGGACTCAAACTTGATTTGGATGGGATGGATCGCGTTATCTTGGA
TTTTATGGCCATGACCAAAAAGCAATGAGACACAGTGACAGTGACGCTTTTGAAGTACCAGGTGAGTGTTATAGC
TAAACGGTAATTCTAACAAGCATTAACTCAAAATATCTGTAGGGGCACTTTGCTCCGTGCAATTATCGAGTAGTT
GCTAGGCCATGTTCTGTAGGAGCTTATACATCTTTTATTATTCAATCACCTATCTTCTCCAGAACAACGCAGTTG
CGTATGCATCGCTTACTGCCTAATAGCGATAATGCGACGCCATTCCAAGAGAGACGGAAAGAATCGAAAAGCCAA
GAGTCTGGTAGCTTGTTTACCATAGAATTTGCGGGAATGTCGCATCGTTCTAGAAGACTCATCATACCCGCTGGG
CAGCGGTTTTACACCCCCGTGCCCCACTGTGCTTTGTTGGGCAACTCGGTCATTGTGTTAGCTTTATTTTACATT
TCTTGACCTAAGAAAGGATGACTACCGTAAGAGCCTGTATTATATCTTATCATCCGGTCATCCTCTAACATCTTT
GCATAAAGTTCGTAACTCGCAAATGTCGACAGAGGGCGCAGCCTCTTCCGTCTACTATTACTTTTCTCCTCTGGA
CCACGTTTACGTTTTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail