Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|025990
Gene name
Locationscaffold_11:1133949..1138356
Strand-
Gene length (bp)4407
Transcript length (bp)4407
Coding sequence length (bp)4407
Protein length (aa) 1469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.8E-48 977 1217
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.7E-12 517 587
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.1E-11 95 222

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 406 1457 1.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 909 1459 2.0E-94
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 406 830 5.0E-45
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1141 1369 4.0E-35
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1057 1366 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 406 1457 1.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 909 1459 2.0E-94
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 406 830 5.0E-45
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1141 1369 4.0E-35
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1057 1366 2.0E-34
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 381 849 6.0E-25
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 381 849 9.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 381 847 9.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 381 849 1.0E-24
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 381 847 1.0E-24
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 381 847 1.0E-24
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 381 847 1.0E-24
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 381 847 1.0E-24
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 381 847 1.0E-24
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 381 847 2.0E-24
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 381 849 2.0E-24
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 381 849 2.0E-24
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 445 825 2.0E-24
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 406 797 4.0E-24
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 406 797 4.0E-24
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 445 825 4.0E-24
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 445 797 5.0E-24
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 445 797 5.0E-24
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 406 797 5.0E-24
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 384 797 5.0E-24
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 406 797 5.0E-24
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 406 797 5.0E-24
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 445 797 6.0E-24
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 445 797 6.0E-24
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 445 797 6.0E-24
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 445 797 6.0E-24
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 384 797 6.0E-24
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 445 797 6.0E-24
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 406 797 6.0E-24
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 384 797 7.0E-24
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 445 797 7.0E-24
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 445 797 7.0E-24
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 445 797 7.0E-24
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 445 797 7.0E-24
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 384 797 8.0E-24
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 406 797 8.0E-24
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 406 797 8.0E-24
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 445 797 8.0E-24
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 445 797 8.0E-24
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 406 797 8.0E-24
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 445 797 8.0E-24
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 406 797 8.0E-24
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 445 797 2.0E-23
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 445 797 5.0E-23
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 404 746 6.0E-22
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 952 1445 9.0E-22
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 404 746 1.0E-21
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 404 746 1.0E-21
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 952 1445 3.0E-21
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 952 1445 6.0E-21
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 988 1445 1.0E-20
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 988 1445 1.0E-20
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 988 1445 2.0E-20
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 988 1445 2.0E-20
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 988 1445 2.0E-20
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 988 1445 2.0E-20
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 988 1445 2.0E-20
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 988 1445 3.0E-20
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 988 1445 3.0E-20
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 952 1445 8.0E-20
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 952 1445 2.0E-19
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 988 1445 2.0E-19
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 952 1445 2.0E-19
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 988 1445 2.0E-19
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 952 1445 2.0E-18
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 988 1445 2.0E-18
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 988 1445 2.0E-18
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 988 1445 2.0E-18
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 952 1445 2.0E-18
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 952 1445 2.0E-18
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 988 1445 2.0E-18
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 988 1445 2.0E-18
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 952 1445 3.0E-18
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 988 1445 3.0E-18
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 988 1445 6.0E-18
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 952 1445 6.0E-18
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 988 1445 1.0E-17
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 952 1445 1.0E-17
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 988 1445 2.0E-17
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 988 1445 2.0E-17
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 988 1445 2.0E-17
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 952 1445 2.0E-17
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 952 1445 2.0E-17
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 952 1445 2.0E-17
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 524 797 2.0E-17
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 988 1445 3.0E-17
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 952 1445 1.0E-16
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 952 1445 1.0E-16
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 988 1445 1.0E-16
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 952 1445 2.0E-16
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 952 1445 2.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1011 1446 5.0E-14
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 911 1446 8.0E-14
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 943 1047 7.0E-13
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 988 1305 3.0E-10
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 714 821 2.0E-08
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1251 1333 6.0E-08
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 577 748 3.0E-07
sp|P93293|M300_ARATH Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana GN=AtMg00300 PE=4 SV=1 479 616 4.0E-06
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 577 748 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|025990
MSNNTGGSAPPIFADTAKFNGTNWVSWSGMIRIAAELRGVSGYLDGTVINPATVNSAQTIPVITTTPSPTTTTAT
TTSTPSETPWESTTPRTAEWKVRNAWTMGLLIYNTTDPIGLGISIGGTAADAWKSYLDTYEVASEIATLNAEMEL
RNMVYTDGQDFTEFISRLRTKWSNANALGAKIDDKAFRTIILNSLPRSWDSIVATLYTTKTSREAISQLLTHWAR
VSRDRVTTSQTTSALQTTTTQSNNRNRQRSQNSQLTCTNPNCGRRGHTIEFCYWPGGGKAGQFPPGFGRRGGAGG
SASNTATGGYQPSANNATTNTTEKTESNEPKVFALAAITDTIDDTPKVPSTLPVLSNNPDGSLISTPSVSERPYA
EICVTGKDQRVSVSTTLNTTTSTLPYDVITLLDSGASDHCFVNKSLFATYVPMIPPRQGNSAGKGSTFLIEGAGE
VGFFTSLDGAPTKIILFDALHTPQLRSNLISVSKLVSRGSSVSFEGNTAVVRTRSGAVALVAMKENGLYVVPPVD
VHANAVQSKRKAVSLGTWHRRLGHASVEVIKRMLRENLVDGLSVTGPMELEGLCEDCIFGKHTSHPYNNSTSQEK
SPLERVYIDIWGPSPVQSAGGAKYFMLIIDGATSYRKLHFLTSKSADSTLTAFKEFHREAERQTGETLKEVRLDM
GREWYNELWSAYVKEHGIVLNFATPYAHQQNGKAERSMRTLLDMARTLLADSGLPQKYWADAVQTAAYVRNLTPT
SGDPTNIPAQRWTSQRQDISHLRPFGSTAYAHIPVEVHSSKLSPRSVKLTLLGYYGHTAYKLMDRTTGAVYKSRD
VIFEEARPHLSTDTITTFSGDDSRSSNRQEIAPRPLPINTLHGVDNSTTTITPLAVPAPTQGGTASATGDEALDV
TEGVKEPPLVLRRSQRESKPSQRMKESLEYLRRPEAHATESITEDSRVPKNHHEAMRRPDLWLEPMMKELNVMTE
KQVFRLVPRPTGRNVVKSRWVFANKYDEAGTVVSRKARLVAKGFTQVIGEDYDETYASVARLESVRMVCAIAASR
GLRLWQVDFVSAFLNSENSFEVYMEQPPGFEEGGDHVWLLLKTLYGTMQGAHDWAQTLDRTYAGHGYYISKADPQ
VRSKVEGDEFTLTSTWTDDVLGASSTTDGEAKAKDELGRSYEIKDLGEAKFILGMRIERGRNGNVRLSQRAYCER
IIERFKQLDLKPRSTPLPVGVTLSIEGSPDSDEEKADMKNVPYREVLSSLMWLQVATRPDLSYAVNILSRFANNP
GRSHWDAMKHTLGYIKGTMDYGITYYRDATIKPLGYVDSDFAGDIDSRRSTEGHVFFVAGGPISWASRRQDTVAL
STVEAEYMAFSRAVQQAIWLANFLKEVGLPQDAPTVIHADNDGSIANTRTYKNHRRTKHIDIRYHFIKERTANGD
VVFEYVPSADNLADIFTKPLSRDVVLRLCGDMGLRSVEPGGVL*
Coding >AgabiH97|025990
ATGTCTAACAACACCGGTGGTAGCGCTCCTCCTATTTTCGCTGATACGGCGAAATTTAATGGCACCAACTGGGTG
TCATGGAGCGGAATGATTCGTATCGCTGCGGAGCTGCGAGGCGTGTCTGGGTACCTCGATGGTACGGTCATTAAT
CCAGCCACTGTTAACTCTGCACAAACCATCCCTGTTATCACGACAACACCATCCCCTACTACGACTACAGCTACC
ACTACTTCCACACCTTCTGAGACCCCATGGGAATCCACCACCCCACGCACTGCCGAATGGAAAGTCCGCAATGCC
TGGACTATGGGTCTCCTCATTTACAACACAACCGACCCTATCGGCCTTGGTATCTCTATCGGAGGAACAGCAGCC
GATGCTTGGAAGTCGTACCTCGACACCTATGAGGTCGCATCCGAGATTGCTACCCTTAACGCCGAAATGGAGTTG
AGAAATATGGTATACACAGACGGGCAGGATTTCACTGAATTCATATCACGCCTCAGAACTAAGTGGTCAAACGCA
AATGCTCTTGGGGCGAAAATTGACGATAAAGCATTCCGAACAATTATCTTGAACTCCTTGCCCCGCTCCTGGGAT
TCCATTGTTGCTACTCTGTACACCACCAAAACGTCGCGGGAGGCTATAAGCCAACTTCTAACCCATTGGGCCAGA
GTCAGCCGTGATCGAGTCACTACGTCGCAGACTACTTCAGCTCTCCAAACTACTACCACACAGTCGAACAATCGC
AACCGTCAACGAAGCCAAAACAGTCAATTAACTTGCACCAATCCCAATTGTGGTCGTAGGGGACATACCATCGAG
TTTTGTTACTGGCCAGGTGGTGGAAAGGCCGGGCAGTTTCCGCCTGGTTTTGGACGACGTGGGGGAGCAGGAGGT
AGTGCCAGCAACACTGCTACCGGAGGATATCAACCTTCTGCAAACAACGCCACTACCAACACCACGGAGAAGACG
GAAAGCAACGAACCGAAGGTCTTCGCTCTCGCTGCGATCACGGACACAATCGACGATACGCCAAAGGTACCATCT
ACCCTCCCAGTACTTTCCAACAATCCTGACGGCTCTTTGATTTCAACCCCTAGTGTCTCTGAGAGACCATATGCT
GAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGTTAGTACCACATTGAATACAACTACTTCCACTCTACCT
TACGACGTGATTACTCTGCTCGATTCCGGGGCGAGCGACCATTGCTTCGTTAATAAATCACTCTTCGCTACATAT
GTTCCGATGATCCCACCTCGACAAGGAAACTCCGCAGGCAAAGGTTCTACTTTTCTGATAGAGGGTGCGGGTGAA
GTTGGCTTCTTCACTTCTCTTGACGGGGCGCCAACGAAGATAATTTTGTTTGATGCGCTCCATACCCCGCAACTG
AGGTCAAACCTGATCTCGGTCTCCAAGCTTGTATCACGGGGATCATCCGTTAGTTTTGAGGGGAATACAGCAGTT
GTTCGTACCCGTAGCGGCGCAGTTGCATTGGTAGCCATGAAAGAGAATGGTCTATATGTTGTACCGCCGGTTGAC
GTCCATGCGAATGCCGTGCAATCGAAAAGGAAAGCTGTATCTTTGGGAACTTGGCACCGTCGTCTCGGCCACGCC
AGCGTGGAAGTCATCAAAAGGATGTTACGCGAAAACCTCGTAGATGGCTTGAGTGTTACAGGACCTATGGAGTTG
GAAGGGCTCTGTGAAGACTGTATCTTCGGCAAACATACCTCACATCCATACAATAATTCCACATCGCAGGAGAAA
TCCCCGCTCGAACGTGTTTACATCGACATATGGGGTCCTTCCCCGGTTCAATCTGCTGGGGGAGCAAAGTACTTC
ATGTTAATCATTGACGGCGCCACATCCTATAGAAAATTGCATTTTCTTACTTCTAAGTCAGCGGATTCAACGTTA
ACGGCCTTCAAGGAGTTTCATAGAGAAGCGGAGAGACAGACTGGTGAAACATTGAAGGAAGTTCGTTTAGACATG
GGACGCGAATGGTACAATGAACTTTGGAGCGCATACGTAAAAGAGCACGGCATTGTCTTGAACTTTGCCACGCCT
TACGCCCACCAGCAAAATGGCAAGGCAGAGCGCTCTATGCGTACCCTGCTGGATATGGCGCGTACTCTGCTAGCG
GACTCCGGTCTTCCACAGAAATACTGGGCAGATGCTGTCCAAACCGCCGCCTATGTACGAAACCTCACTCCTACA
TCTGGTGACCCTACCAATATCCCCGCTCAACGCTGGACTAGCCAACGACAAGACATATCACACCTCCGTCCTTTT
GGGTCTACTGCCTACGCACACATACCTGTCGAAGTACACTCCTCAAAATTGTCTCCTCGCTCAGTGAAGCTCACT
CTGCTTGGGTATTATGGTCACACCGCCTACAAGCTGATGGATCGTACCACCGGCGCCGTTTATAAATCGAGGGAT
GTGATTTTCGAGGAGGCTCGTCCCCATCTTTCCACTGATACCATCACAACCTTCTCTGGGGACGACTCTCGTAGC
TCAAATCGCCAGGAAATCGCACCACGTCCTTTGCCAATTAATACGCTCCATGGTGTGGACAACAGTACTACTACG
ATAACGCCATTGGCTGTACCGGCACCGACACAAGGTGGTACAGCCTCCGCTACGGGAGACGAGGCCTTAGATGTT
ACGGAGGGTGTTAAAGAGCCGCCTTTGGTATTGAGGAGAAGCCAGAGGGAATCAAAACCGTCACAACGTATGAAA
GAGAGTCTGGAATACCTACGACGTCCAGAGGCGCATGCAACAGAATCTATTACGGAGGATTCTCGTGTGCCGAAG
AACCATCATGAGGCGATGAGGAGACCGGATTTATGGCTTGAACCAATGATGAAGGAGCTGAATGTGATGACAGAG
AAGCAGGTATTCAGGCTTGTTCCTCGCCCAACTGGAAGAAATGTTGTCAAATCGAGATGGGTATTCGCAAACAAG
TATGATGAGGCGGGTACAGTGGTGAGCCGAAAGGCACGGCTGGTAGCAAAAGGATTCACACAAGTCATCGGCGAG
GACTATGACGAAACTTACGCCTCGGTTGCACGCCTGGAGTCAGTACGGATGGTATGTGCCATCGCTGCCTCACGT
GGTCTTCGACTGTGGCAGGTCGACTTCGTCTCCGCTTTCCTCAACAGCGAGAACTCTTTTGAAGTGTACATGGAA
CAACCTCCTGGTTTTGAGGAGGGGGGAGACCATGTATGGTTGCTCCTCAAAACGCTGTACGGGACGATGCAAGGC
GCCCATGACTGGGCACAGACTCTCGATCGCACCTACGCGGGTCATGGGTACTACATATCGAAAGCTGACCCCCAA
GTGCGATCAAAGGTGGAAGGTGATGAATTTACACTTACGTCAACCTGGACAGACGATGTCCTCGGCGCCTCGTCG
ACAACAGATGGTGAAGCAAAGGCTAAGGATGAGTTGGGAAGAAGCTATGAAATCAAGGATCTGGGGGAGGCGAAG
TTTATTCTTGGGATGAGAATCGAGAGGGGAAGGAACGGCAATGTCAGACTATCACAACGAGCTTACTGCGAGCGC
ATCATCGAACGTTTCAAACAATTGGACTTGAAACCACGTTCTACTCCACTTCCAGTTGGAGTAACTTTATCCATT
GAAGGCTCGCCGGACTCCGACGAAGAGAAGGCTGACATGAAGAACGTACCCTATCGTGAAGTCCTCAGCTCCCTT
ATGTGGCTTCAGGTCGCAACTCGCCCCGATTTATCCTACGCTGTGAACATTCTCTCTCGTTTTGCGAATAACCCA
GGACGCAGCCACTGGGACGCTATGAAGCACACTCTGGGATACATTAAAGGAACTATGGACTATGGAATCACTTAC
TACCGTGACGCAACTATCAAACCTTTGGGCTACGTGGATTCAGATTTTGCTGGTGACATCGACTCTCGACGTTCT
ACGGAGGGACATGTTTTCTTTGTAGCAGGTGGACCTATATCATGGGCCAGCAGACGACAGGATACCGTGGCTCTG
TCCACTGTAGAGGCGGAGTATATGGCTTTTAGCCGCGCCGTTCAGCAGGCAATCTGGCTTGCGAACTTCCTGAAA
GAAGTGGGTTTGCCACAGGATGCACCTACGGTGATACACGCTGACAATGATGGGTCTATTGCCAATACGCGAACC
TACAAGAACCATCGGAGGACGAAACACATTGATATCAGATACCATTTCATAAAAGAGAGAACTGCAAACGGAGAT
GTTGTTTTCGAGTATGTTCCTTCCGCAGACAATTTAGCCGACATCTTCACAAAACCCCTCTCGCGTGATGTGGTC
TTGCGACTTTGTGGAGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTGTGA
Transcript >AgabiH97|025990
ATGTCTAACAACACCGGTGGTAGCGCTCCTCCTATTTTCGCTGATACGGCGAAATTTAATGGCACCAACTGGGTG
TCATGGAGCGGAATGATTCGTATCGCTGCGGAGCTGCGAGGCGTGTCTGGGTACCTCGATGGTACGGTCATTAAT
CCAGCCACTGTTAACTCTGCACAAACCATCCCTGTTATCACGACAACACCATCCCCTACTACGACTACAGCTACC
ACTACTTCCACACCTTCTGAGACCCCATGGGAATCCACCACCCCACGCACTGCCGAATGGAAAGTCCGCAATGCC
TGGACTATGGGTCTCCTCATTTACAACACAACCGACCCTATCGGCCTTGGTATCTCTATCGGAGGAACAGCAGCC
GATGCTTGGAAGTCGTACCTCGACACCTATGAGGTCGCATCCGAGATTGCTACCCTTAACGCCGAAATGGAGTTG
AGAAATATGGTATACACAGACGGGCAGGATTTCACTGAATTCATATCACGCCTCAGAACTAAGTGGTCAAACGCA
AATGCTCTTGGGGCGAAAATTGACGATAAAGCATTCCGAACAATTATCTTGAACTCCTTGCCCCGCTCCTGGGAT
TCCATTGTTGCTACTCTGTACACCACCAAAACGTCGCGGGAGGCTATAAGCCAACTTCTAACCCATTGGGCCAGA
GTCAGCCGTGATCGAGTCACTACGTCGCAGACTACTTCAGCTCTCCAAACTACTACCACACAGTCGAACAATCGC
AACCGTCAACGAAGCCAAAACAGTCAATTAACTTGCACCAATCCCAATTGTGGTCGTAGGGGACATACCATCGAG
TTTTGTTACTGGCCAGGTGGTGGAAAGGCCGGGCAGTTTCCGCCTGGTTTTGGACGACGTGGGGGAGCAGGAGGT
AGTGCCAGCAACACTGCTACCGGAGGATATCAACCTTCTGCAAACAACGCCACTACCAACACCACGGAGAAGACG
GAAAGCAACGAACCGAAGGTCTTCGCTCTCGCTGCGATCACGGACACAATCGACGATACGCCAAAGGTACCATCT
ACCCTCCCAGTACTTTCCAACAATCCTGACGGCTCTTTGATTTCAACCCCTAGTGTCTCTGAGAGACCATATGCT
GAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGTTAGTACCACATTGAATACAACTACTTCCACTCTACCT
TACGACGTGATTACTCTGCTCGATTCCGGGGCGAGCGACCATTGCTTCGTTAATAAATCACTCTTCGCTACATAT
GTTCCGATGATCCCACCTCGACAAGGAAACTCCGCAGGCAAAGGTTCTACTTTTCTGATAGAGGGTGCGGGTGAA
GTTGGCTTCTTCACTTCTCTTGACGGGGCGCCAACGAAGATAATTTTGTTTGATGCGCTCCATACCCCGCAACTG
AGGTCAAACCTGATCTCGGTCTCCAAGCTTGTATCACGGGGATCATCCGTTAGTTTTGAGGGGAATACAGCAGTT
GTTCGTACCCGTAGCGGCGCAGTTGCATTGGTAGCCATGAAAGAGAATGGTCTATATGTTGTACCGCCGGTTGAC
GTCCATGCGAATGCCGTGCAATCGAAAAGGAAAGCTGTATCTTTGGGAACTTGGCACCGTCGTCTCGGCCACGCC
AGCGTGGAAGTCATCAAAAGGATGTTACGCGAAAACCTCGTAGATGGCTTGAGTGTTACAGGACCTATGGAGTTG
GAAGGGCTCTGTGAAGACTGTATCTTCGGCAAACATACCTCACATCCATACAATAATTCCACATCGCAGGAGAAA
TCCCCGCTCGAACGTGTTTACATCGACATATGGGGTCCTTCCCCGGTTCAATCTGCTGGGGGAGCAAAGTACTTC
ATGTTAATCATTGACGGCGCCACATCCTATAGAAAATTGCATTTTCTTACTTCTAAGTCAGCGGATTCAACGTTA
ACGGCCTTCAAGGAGTTTCATAGAGAAGCGGAGAGACAGACTGGTGAAACATTGAAGGAAGTTCGTTTAGACATG
GGACGCGAATGGTACAATGAACTTTGGAGCGCATACGTAAAAGAGCACGGCATTGTCTTGAACTTTGCCACGCCT
TACGCCCACCAGCAAAATGGCAAGGCAGAGCGCTCTATGCGTACCCTGCTGGATATGGCGCGTACTCTGCTAGCG
GACTCCGGTCTTCCACAGAAATACTGGGCAGATGCTGTCCAAACCGCCGCCTATGTACGAAACCTCACTCCTACA
TCTGGTGACCCTACCAATATCCCCGCTCAACGCTGGACTAGCCAACGACAAGACATATCACACCTCCGTCCTTTT
GGGTCTACTGCCTACGCACACATACCTGTCGAAGTACACTCCTCAAAATTGTCTCCTCGCTCAGTGAAGCTCACT
CTGCTTGGGTATTATGGTCACACCGCCTACAAGCTGATGGATCGTACCACCGGCGCCGTTTATAAATCGAGGGAT
GTGATTTTCGAGGAGGCTCGTCCCCATCTTTCCACTGATACCATCACAACCTTCTCTGGGGACGACTCTCGTAGC
TCAAATCGCCAGGAAATCGCACCACGTCCTTTGCCAATTAATACGCTCCATGGTGTGGACAACAGTACTACTACG
ATAACGCCATTGGCTGTACCGGCACCGACACAAGGTGGTACAGCCTCCGCTACGGGAGACGAGGCCTTAGATGTT
ACGGAGGGTGTTAAAGAGCCGCCTTTGGTATTGAGGAGAAGCCAGAGGGAATCAAAACCGTCACAACGTATGAAA
GAGAGTCTGGAATACCTACGACGTCCAGAGGCGCATGCAACAGAATCTATTACGGAGGATTCTCGTGTGCCGAAG
AACCATCATGAGGCGATGAGGAGACCGGATTTATGGCTTGAACCAATGATGAAGGAGCTGAATGTGATGACAGAG
AAGCAGGTATTCAGGCTTGTTCCTCGCCCAACTGGAAGAAATGTTGTCAAATCGAGATGGGTATTCGCAAACAAG
TATGATGAGGCGGGTACAGTGGTGAGCCGAAAGGCACGGCTGGTAGCAAAAGGATTCACACAAGTCATCGGCGAG
GACTATGACGAAACTTACGCCTCGGTTGCACGCCTGGAGTCAGTACGGATGGTATGTGCCATCGCTGCCTCACGT
GGTCTTCGACTGTGGCAGGTCGACTTCGTCTCCGCTTTCCTCAACAGCGAGAACTCTTTTGAAGTGTACATGGAA
CAACCTCCTGGTTTTGAGGAGGGGGGAGACCATGTATGGTTGCTCCTCAAAACGCTGTACGGGACGATGCAAGGC
GCCCATGACTGGGCACAGACTCTCGATCGCACCTACGCGGGTCATGGGTACTACATATCGAAAGCTGACCCCCAA
GTGCGATCAAAGGTGGAAGGTGATGAATTTACACTTACGTCAACCTGGACAGACGATGTCCTCGGCGCCTCGTCG
ACAACAGATGGTGAAGCAAAGGCTAAGGATGAGTTGGGAAGAAGCTATGAAATCAAGGATCTGGGGGAGGCGAAG
TTTATTCTTGGGATGAGAATCGAGAGGGGAAGGAACGGCAATGTCAGACTATCACAACGAGCTTACTGCGAGCGC
ATCATCGAACGTTTCAAACAATTGGACTTGAAACCACGTTCTACTCCACTTCCAGTTGGAGTAACTTTATCCATT
GAAGGCTCGCCGGACTCCGACGAAGAGAAGGCTGACATGAAGAACGTACCCTATCGTGAAGTCCTCAGCTCCCTT
ATGTGGCTTCAGGTCGCAACTCGCCCCGATTTATCCTACGCTGTGAACATTCTCTCTCGTTTTGCGAATAACCCA
GGACGCAGCCACTGGGACGCTATGAAGCACACTCTGGGATACATTAAAGGAACTATGGACTATGGAATCACTTAC
TACCGTGACGCAACTATCAAACCTTTGGGCTACGTGGATTCAGATTTTGCTGGTGACATCGACTCTCGACGTTCT
ACGGAGGGACATGTTTTCTTTGTAGCAGGTGGACCTATATCATGGGCCAGCAGACGACAGGATACCGTGGCTCTG
TCCACTGTAGAGGCGGAGTATATGGCTTTTAGCCGCGCCGTTCAGCAGGCAATCTGGCTTGCGAACTTCCTGAAA
GAAGTGGGTTTGCCACAGGATGCACCTACGGTGATACACGCTGACAATGATGGGTCTATTGCCAATACGCGAACC
TACAAGAACCATCGGAGGACGAAACACATTGATATCAGATACCATTTCATAAAAGAGAGAACTGCAAACGGAGAT
GTTGTTTTCGAGTATGTTCCTTCCGCAGACAATTTAGCCGACATCTTCACAAAACCCCTCTCGCGTGATGTGGTC
TTGCGACTTTGTGGAGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTGTGA
Gene >AgabiH97|025990
ATGTCTAACAACACCGGTGGTAGCGCTCCTCCTATTTTCGCTGATACGGCGAAATTTAATGGCACCAACTGGGTG
TCATGGAGCGGAATGATTCGTATCGCTGCGGAGCTGCGAGGCGTGTCTGGGTACCTCGATGGTACGGTCATTAAT
CCAGCCACTGTTAACTCTGCACAAACCATCCCTGTTATCACGACAACACCATCCCCTACTACGACTACAGCTACC
ACTACTTCCACACCTTCTGAGACCCCATGGGAATCCACCACCCCACGCACTGCCGAATGGAAAGTCCGCAATGCC
TGGACTATGGGTCTCCTCATTTACAACACAACCGACCCTATCGGCCTTGGTATCTCTATCGGAGGAACAGCAGCC
GATGCTTGGAAGTCGTACCTCGACACCTATGAGGTCGCATCCGAGATTGCTACCCTTAACGCCGAAATGGAGTTG
AGAAATATGGTATACACAGACGGGCAGGATTTCACTGAATTCATATCACGCCTCAGAACTAAGTGGTCAAACGCA
AATGCTCTTGGGGCGAAAATTGACGATAAAGCATTCCGAACAATTATCTTGAACTCCTTGCCCCGCTCCTGGGAT
TCCATTGTTGCTACTCTGTACACCACCAAAACGTCGCGGGAGGCTATAAGCCAACTTCTAACCCATTGGGCCAGA
GTCAGCCGTGATCGAGTCACTACGTCGCAGACTACTTCAGCTCTCCAAACTACTACCACACAGTCGAACAATCGC
AACCGTCAACGAAGCCAAAACAGTCAATTAACTTGCACCAATCCCAATTGTGGTCGTAGGGGACATACCATCGAG
TTTTGTTACTGGCCAGGTGGTGGAAAGGCCGGGCAGTTTCCGCCTGGTTTTGGACGACGTGGGGGAGCAGGAGGT
AGTGCCAGCAACACTGCTACCGGAGGATATCAACCTTCTGCAAACAACGCCACTACCAACACCACGGAGAAGACG
GAAAGCAACGAACCGAAGGTCTTCGCTCTCGCTGCGATCACGGACACAATCGACGATACGCCAAAGGTACCATCT
ACCCTCCCAGTACTTTCCAACAATCCTGACGGCTCTTTGATTTCAACCCCTAGTGTCTCTGAGAGACCATATGCT
GAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGTTAGTACCACATTGAATACAACTACTTCCACTCTACCT
TACGACGTGATTACTCTGCTCGATTCCGGGGCGAGCGACCATTGCTTCGTTAATAAATCACTCTTCGCTACATAT
GTTCCGATGATCCCACCTCGACAAGGAAACTCCGCAGGCAAAGGTTCTACTTTTCTGATAGAGGGTGCGGGTGAA
GTTGGCTTCTTCACTTCTCTTGACGGGGCGCCAACGAAGATAATTTTGTTTGATGCGCTCCATACCCCGCAACTG
AGGTCAAACCTGATCTCGGTCTCCAAGCTTGTATCACGGGGATCATCCGTTAGTTTTGAGGGGAATACAGCAGTT
GTTCGTACCCGTAGCGGCGCAGTTGCATTGGTAGCCATGAAAGAGAATGGTCTATATGTTGTACCGCCGGTTGAC
GTCCATGCGAATGCCGTGCAATCGAAAAGGAAAGCTGTATCTTTGGGAACTTGGCACCGTCGTCTCGGCCACGCC
AGCGTGGAAGTCATCAAAAGGATGTTACGCGAAAACCTCGTAGATGGCTTGAGTGTTACAGGACCTATGGAGTTG
GAAGGGCTCTGTGAAGACTGTATCTTCGGCAAACATACCTCACATCCATACAATAATTCCACATCGCAGGAGAAA
TCCCCGCTCGAACGTGTTTACATCGACATATGGGGTCCTTCCCCGGTTCAATCTGCTGGGGGAGCAAAGTACTTC
ATGTTAATCATTGACGGCGCCACATCCTATAGAAAATTGCATTTTCTTACTTCTAAGTCAGCGGATTCAACGTTA
ACGGCCTTCAAGGAGTTTCATAGAGAAGCGGAGAGACAGACTGGTGAAACATTGAAGGAAGTTCGTTTAGACATG
GGACGCGAATGGTACAATGAACTTTGGAGCGCATACGTAAAAGAGCACGGCATTGTCTTGAACTTTGCCACGCCT
TACGCCCACCAGCAAAATGGCAAGGCAGAGCGCTCTATGCGTACCCTGCTGGATATGGCGCGTACTCTGCTAGCG
GACTCCGGTCTTCCACAGAAATACTGGGCAGATGCTGTCCAAACCGCCGCCTATGTACGAAACCTCACTCCTACA
TCTGGTGACCCTACCAATATCCCCGCTCAACGCTGGACTAGCCAACGACAAGACATATCACACCTCCGTCCTTTT
GGGTCTACTGCCTACGCACACATACCTGTCGAAGTACACTCCTCAAAATTGTCTCCTCGCTCAGTGAAGCTCACT
CTGCTTGGGTATTATGGTCACACCGCCTACAAGCTGATGGATCGTACCACCGGCGCCGTTTATAAATCGAGGGAT
GTGATTTTCGAGGAGGCTCGTCCCCATCTTTCCACTGATACCATCACAACCTTCTCTGGGGACGACTCTCGTAGC
TCAAATCGCCAGGAAATCGCACCACGTCCTTTGCCAATTAATACGCTCCATGGTGTGGACAACAGTACTACTACG
ATAACGCCATTGGCTGTACCGGCACCGACACAAGGTGGTACAGCCTCCGCTACGGGAGACGAGGCCTTAGATGTT
ACGGAGGGTGTTAAAGAGCCGCCTTTGGTATTGAGGAGAAGCCAGAGGGAATCAAAACCGTCACAACGTATGAAA
GAGAGTCTGGAATACCTACGACGTCCAGAGGCGCATGCAACAGAATCTATTACGGAGGATTCTCGTGTGCCGAAG
AACCATCATGAGGCGATGAGGAGACCGGATTTATGGCTTGAACCAATGATGAAGGAGCTGAATGTGATGACAGAG
AAGCAGGTATTCAGGCTTGTTCCTCGCCCAACTGGAAGAAATGTTGTCAAATCGAGATGGGTATTCGCAAACAAG
TATGATGAGGCGGGTACAGTGGTGAGCCGAAAGGCACGGCTGGTAGCAAAAGGATTCACACAAGTCATCGGCGAG
GACTATGACGAAACTTACGCCTCGGTTGCACGCCTGGAGTCAGTACGGATGGTATGTGCCATCGCTGCCTCACGT
GGTCTTCGACTGTGGCAGGTCGACTTCGTCTCCGCTTTCCTCAACAGCGAGAACTCTTTTGAAGTGTACATGGAA
CAACCTCCTGGTTTTGAGGAGGGGGGAGACCATGTATGGTTGCTCCTCAAAACGCTGTACGGGACGATGCAAGGC
GCCCATGACTGGGCACAGACTCTCGATCGCACCTACGCGGGTCATGGGTACTACATATCGAAAGCTGACCCCCAA
GTGCGATCAAAGGTGGAAGGTGATGAATTTACACTTACGTCAACCTGGACAGACGATGTCCTCGGCGCCTCGTCG
ACAACAGATGGTGAAGCAAAGGCTAAGGATGAGTTGGGAAGAAGCTATGAAATCAAGGATCTGGGGGAGGCGAAG
TTTATTCTTGGGATGAGAATCGAGAGGGGAAGGAACGGCAATGTCAGACTATCACAACGAGCTTACTGCGAGCGC
ATCATCGAACGTTTCAAACAATTGGACTTGAAACCACGTTCTACTCCACTTCCAGTTGGAGTAACTTTATCCATT
GAAGGCTCGCCGGACTCCGACGAAGAGAAGGCTGACATGAAGAACGTACCCTATCGTGAAGTCCTCAGCTCCCTT
ATGTGGCTTCAGGTCGCAACTCGCCCCGATTTATCCTACGCTGTGAACATTCTCTCTCGTTTTGCGAATAACCCA
GGACGCAGCCACTGGGACGCTATGAAGCACACTCTGGGATACATTAAAGGAACTATGGACTATGGAATCACTTAC
TACCGTGACGCAACTATCAAACCTTTGGGCTACGTGGATTCAGATTTTGCTGGTGACATCGACTCTCGACGTTCT
ACGGAGGGACATGTTTTCTTTGTAGCAGGTGGACCTATATCATGGGCCAGCAGACGACAGGATACCGTGGCTCTG
TCCACTGTAGAGGCGGAGTATATGGCTTTTAGCCGCGCCGTTCAGCAGGCAATCTGGCTTGCGAACTTCCTGAAA
GAAGTGGGTTTGCCACAGGATGCACCTACGGTGATACACGCTGACAATGATGGGTCTATTGCCAATACGCGAACC
TACAAGAACCATCGGAGGACGAAACACATTGATATCAGATACCATTTCATAAAAGAGAGAACTGCAAACGGAGAT
GTTGTTTTCGAGTATGTTCCTTCCGCAGACAATTTAGCCGACATCTTCACAAAACCCCTCTCGCGTGATGTGGTC
TTGCGACTTTGTGGAGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail