Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|025890
Gene name
Locationscaffold_11:1112963..1114181
Strand-
Gene length (bp)1218
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10455 BAR_2 Bin/amphiphysin/Rvs domain for vesicular trafficking 3.8E-48 32 290
PF03114 BAR BAR domain 6.5E-14 24 294

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40531|GVP36_YEAST Protein GVP36 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GVP36 PE=1 SV=1 35 284 7.0E-34
sp|Q10253|MUG64_SCHPO Meiotically up-regulated gene 64 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug64 PE=1 SV=3 49 290 1.0E-17
sp|Q9U8G7|P29_ECHGR Hydatid disease diagnostic antigen P-29 OS=Echinococcus granulosus PE=1 SV=1 76 293 1.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005737 cytoplasm Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|025890
MDGWKALQSSIGSINFAQAGSKLSKGFNHSVQATRERLGQVAPEDITELPQEYKDLEARVDALRSAHLAVLKITR
VYDNETYDYPNQIQESISELSTSIGYNITSFAAQNLKGTNLPTPAAPAAPENQHKTLPHALTRASATAHATIANT
VGGEQDKLGKALGLYAQGLDKVASARVEQDITIQDGFLHPWQTTLNTSINVAMKARQAVKLSRLELDAAKQSLKN
ANPAKQEQARLEVENAEDDLVQKTEVAITLMKTVLENPEPLKNLNELAKAQLIYFSSAAEALSAVQGEIEELSVA
AEGEYRKSRDH*
Coding >AgabiH97|025890
ATGGACGGCTGGAAAGCACTACAATCAAGTATCGGCTCTATCAACTTTGCCCAGGCTGGCTCAAAGCTCTCCAAG
GGCTTTAATCACAGCGTACAAGCCACCAGGGAGCGTCTCGGCCAGGTGGCCCCAGAAGACATCACAGAGCTGCCC
CAAGAATACAAGGACCTGGAGGCCCGTGTCGACGCACTTCGCTCTGCCCATCTTGCTGTACTCAAGATAACGCGC
GTCTACGACAATGAAACATACGATTATCCCAATCAAATTCAAGAATCGATCTCTGAGCTTTCGACTTCCATTGGT
TACAATATCACCTCTTTCGCGGCACAGAACTTGAAGGGCACGAATCTTCCTACTCCTGCTGCACCTGCTGCACCG
GAAAATCAGCACAAGACCTTGCCGCATGCTCTCACCCGAGCTTCAGCCACTGCCCATGCCACTATCGCGAACACT
GTTGGTGGTGAACAAGATAAGCTCGGCAAAGCGCTAGGATTGTATGCTCAGGGTTTGGATAAGGTAGCGAGTGCA
AGGGTGGAGCAGGATATTACCATTCAAGACGGGTTCTTGCACCCATGGCAAACTACGCTGAATACAAGTATTAAT
GTAGCGATGAAGGCGAGGCAAGCTGTCAAGCTCAGTAGATTGGAATTGGATGCTGCTAAACAATCGTTGAAGAAT
GCAAACCCCGCCAAACAGGAGCAGGCTCGTCTTGAAGTCGAGAATGCTGAGGATGACTTGGTCCAGAAAACTGAG
GTTGCTATCACTCTGATGAAGACCGTTCTCGAGAATCCGGAACCTCTCAAGAACCTCAACGAACTTGCAAAGGCC
CAACTTATCTACTTCTCATCTGCCGCCGAGGCTCTGTCTGCCGTTCAAGGTGAGATCGAAGAGCTCAGCGTGGCT
GCGGAGGGCGAATACAGAAAGTCCAGGGATCACTGA
Transcript >AgabiH97|025890
ATGGACGGCTGGAAAGCACTACAATCAAGTATCGGCTCTATCAACTTTGCCCAGGCTGGCTCAAAGCTCTCCAAG
GGCTTTAATCACAGCGTACAAGCCACCAGGGAGCGTCTCGGCCAGGTGGCCCCAGAAGACATCACAGAGCTGCCC
CAAGAATACAAGGACCTGGAGGCCCGTGTCGACGCACTTCGCTCTGCCCATCTTGCTGTACTCAAGATAACGCGC
GTCTACGACAATGAAACATACGATTATCCCAATCAAATTCAAGAATCGATCTCTGAGCTTTCGACTTCCATTGGT
TACAATATCACCTCTTTCGCGGCACAGAACTTGAAGGGCACGAATCTTCCTACTCCTGCTGCACCTGCTGCACCG
GAAAATCAGCACAAGACCTTGCCGCATGCTCTCACCCGAGCTTCAGCCACTGCCCATGCCACTATCGCGAACACT
GTTGGTGGTGAACAAGATAAGCTCGGCAAAGCGCTAGGATTGTATGCTCAGGGTTTGGATAAGGTAGCGAGTGCA
AGGGTGGAGCAGGATATTACCATTCAAGACGGGTTCTTGCACCCATGGCAAACTACGCTGAATACAAGTATTAAT
GTAGCGATGAAGGCGAGGCAAGCTGTCAAGCTCAGTAGATTGGAATTGGATGCTGCTAAACAATCGTTGAAGAAT
GCAAACCCCGCCAAACAGGAGCAGGCTCGTCTTGAAGTCGAGAATGCTGAGGATGACTTGGTCCAGAAAACTGAG
GTTGCTATCACTCTGATGAAGACCGTTCTCGAGAATCCGGAACCTCTCAAGAACCTCAACGAACTTGCAAAGGCC
CAACTTATCTACTTCTCATCTGCCGCCGAGGCTCTGTCTGCCGTTCAAGGTGAGATCGAAGAGCTCAGCGTGGCT
GCGGAGGGCGAATACAGAAAGTCCAGGGATCACTGA
Gene >AgabiH97|025890
ATGGACGGCTGGAAAGCACTACAATCAAGTATCGGCTCTATCAACTTTGCCCAGGCTGGCTCAAAGCTCTCCAAG
GGCTTTAATCACAGCGTACAAGCCACCAGGGAGCGTCTCGGCCAGGTGGCCCCAGAAGACATCACAGAGCTGCCC
CAAGGTACGCATGGATCGTCCGAACATCCAGTCTACCCTCGAACAATACTTTTTCAGAATACAAGGACCTGGAGG
CCCGTGTCGACGCACTTCGCTCTGCCCATCTTGCTGTACTCAAGTGCGTATCTTGTTTTTCTCGCCTTGTGCGCA
GAAAGTTGAATTGCTGTGGCTAGGATAACGCGCGTCTACGACAATGAAACATACGATTATCCCAATCAAATTCAA
GAATCGATCTCTGAGCTTTCGACTTCCATTGGTTACAATATCACCTCTTTCGCGGCACAGAACTTGAAGGGCACG
AATCTTCCTACTCCTGCTGCACCTGCTGCACCGGAAAATCAGCACAAGACCTTGCCGCATGCTCTCACCCGAGCT
TCAGCCACTGCCCATGCCACTATCGCGAACACTGTTGGTGGTGAACAAGATAAGCTCGGCAAAGCGCTAGGATTG
TATGCTCAGGGTTTGGATAAGGTAGCGAGTGCAAGGGTGGAGCAGGATATTACCATTCAAGACGGGTTCTTGCAC
CCATGGCAAACTACGCTGAATACAAGTATTAATGTAGCGATGAAGGCGAGGCAAGCTGTCAAGCTCAGTAGATTG
GAATTGGATGCTGCTAAACAATCGTGAGTGGCTTCCTCTCTTGCCACTGCTGTTGGAGCCTTACGGTTTTGAGTG
CACAGGTTGAAGAATGCAAACCCCGCCAAACAGGAGCAGGCTCGTCTTGAAGTCGAGAATGCTGAGGATGACTTG
GTCCAGAAAACTGAGGTTGCTATCACTCTGATGAAGACCGTTCTCGAGAATGTGCGGCACTTTTCCTCTGTTATA
TGGTGTTGATTCTGATCCCCCCTGTTTTTATAGCCGGAACCTCTCAAGAACCTCAACGAACTTGCAAAGGCCCAA
CTTATCTACTTCTCATCTGCCGCCGAGGCTCTGTCTGCCGTTCAAGGTGAGATCGAAGAGCTCAGCGTGGCTGCG
GAGGGCGAATACAGGCAAGCAGAATCGATTCACTGAGAGTACCGACATATTGTCCTGATTTTGCTTTCGCGTAGA
AAGTCCAGGGATCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail