Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|025620
Gene name
Locationscaffold_11:1054454..1055039
Strand+
Gene length (bp)585
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08284 RVP_2 Retroviral aspartyl protease 2.4E-11 34 132
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 4.2E-09 26 117
PF13650 Asp_protease_2 Aspartyl protease 9.8E-09 25 115

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 139 4.0E-08
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 139 5.0E-07
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 31 142 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|025620
MNNRYVVPQKRLGVQELEVKSLLTTTNGKKLKVSAMVDSGCTHTCIDEELVKKKKIPMKKLERPITCRNSDGTIA
GKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDIFLGHDWLTNHNPEINWKQGIIKFNQCPTSCSFPHTDISFEP
RIRQLQSNEDTEEKEPDPMNPEDLPAYMKPFAHLFNKKKLRQTA*
Coding >AgabiH97|025620
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAATCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGAACTA
GTAAAGAAGAAGAAGATTCCGATGAAGAAGTTGGAACGACCAATCACATGCAGAAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGTGAAAATGGATCTTAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGACATCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCAGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACAATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAATGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTCAACAAAAAGAAACTTCGACAAACTGCCTGA
Transcript >AgabiH97|025620
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAATCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGAACTA
GTAAAGAAGAAGAAGATTCCGATGAAGAAGTTGGAACGACCAATCACATGCAGAAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGTGAAAATGGATCTTAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGACATCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCAGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACAATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAATGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTCAACAAAAAGAAACTTCGACAAACTGCCTGA
Gene >AgabiH97|025620
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAATCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGAACTA
GTAAAGAAGAAGAAGATTCCGATGAAGAAGTTGGAACGACCAATCACATGCAGAAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGTGAAAATGGATCTTAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGACATCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATAATCAAATTCAACCAGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACAATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAATGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTCAACAAAAAGAAACTTCGACAAACTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail