Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024950
Gene name
Locationscaffold_11:856613..861134
Strand-
Gene length (bp)4521
Transcript length (bp)4521
Coding sequence length (bp)4521
Protein length (aa) 1507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 3.2E-30 1107 1210
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 3.2E-23 1077 1180
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 3.5E-22 849 1011
PF17921 Integrase_H2C2 Integrase zinc binding domain 5.2E-15 1343 1398
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 1.6E-06 573 659
PF13650 Asp_protease_2 Aspartyl protease 2.1E-05 573 656

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 773 1486 4.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 773 1486 4.0E-92
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 773 1486 4.0E-92
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 773 1486 4.0E-92
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 773 1486 4.0E-91
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 773 1486 4.0E-91
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 773 1486 4.0E-91
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 794 1484 4.0E-82
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 794 1484 2.0E-81
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 745 1436 1.0E-76
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 826 1422 2.0E-75
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 812 1422 3.0E-75
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 764 1482 2.0E-67
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 830 1422 2.0E-59
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 794 1230 8.0E-53
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 794 1230 1.0E-50
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 794 1230 5.0E-50
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 794 1230 6.0E-50
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 769 1237 6.0E-50
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 794 1230 1.0E-49
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 794 1230 1.0E-48
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 828 1230 6.0E-41
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 812 1230 4.0E-36
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 835 1230 2.0E-35
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 835 1230 2.0E-35
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 797 1056 6.0E-33
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 729 1230 4.0E-30
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 806 1235 8.0E-28
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 788 1215 1.0E-27
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 810 1168 3.0E-26
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 798 1184 5.0E-26
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 810 1168 4.0E-25
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 759 1193 9.0E-25
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 760 1244 1.0E-24
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 806 1207 3.0E-24
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 797 1230 5.0E-24
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 806 1238 7.0E-24
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 760 1245 2.0E-23
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 774 1184 3.0E-23
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 715 1184 5.0E-23
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 715 1184 6.0E-23
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 715 1184 6.0E-23
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 774 1184 1.0E-22
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 774 1184 3.0E-22
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 774 1184 4.0E-22
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 774 1184 5.0E-22
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 774 1184 2.0E-21
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 661 1054 2.0E-15
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 859 981 9.0E-15
sp|P04026|POL_IPHA Putative Pol polyprotein OS=Hamster intracisternal a-particle H18 GN=pol PE=3 SV=1 820 1052 3.0E-13
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 881 1225 3.0E-13
sp|P11368|POL_IPMA Putative Pol polyprotein OS=Mouse intracisternal a-particle MIA14 GN=pol PE=3 SV=1 820 1052 7.0E-13
sp|P0C211|POL_HTL1L Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Melanesia mel5 subtype C) GN=gag-pro-pol PE=3 SV=2 820 1055 9.0E-13
sp|P03354|POL_RSVP Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Prague C) GN=gag-pro-pol PE=1 SV=2 812 1048 2.0E-12
sp|P14078|POL_HTL1C Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) GN=gag-pro-pol PE=3 SV=3 820 1055 3.0E-12
sp|P63132|PO113_HUMAN Endogenous retrovirus group K member 113 Pol protein OS=Homo sapiens GN=HERVK_113 PE=3 SV=1 791 1017 3.0E-12
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 820 1052 3.0E-12
sp|Q9BXR3|POK6_HUMAN Endogenous retrovirus group K member 6 Pol protein OS=Homo sapiens GN=ERVK-6 PE=2 SV=2 791 1017 4.0E-12
sp|Q9UQG0|POK11_HUMAN Endogenous retrovirus group K member 11 Pol protein OS=Homo sapiens GN=ERVK-11 PE=2 SV=2 791 1017 4.0E-12
sp|Q9QC07|POK18_HUMAN Endogenous retrovirus group K member 18 Pol protein OS=Homo sapiens GN=ERVK-18 PE=3 SV=2 812 1017 4.0E-12
sp|Q7SQ98|POL_ALV Pol polyprotein OS=Avian leukosis virus GN=pol PE=3 SV=1 812 1048 4.0E-12
sp|P63136|POK25_HUMAN Endogenous retrovirus group K member 25 Pol protein OS=Homo sapiens GN=ERVK-25 PE=3 SV=1 791 1017 4.0E-12
sp|P63135|POK7_HUMAN Endogenous retrovirus group K member 7 Pol protein OS=Homo sapiens GN=ERVK-7 PE=3 SV=1 791 1017 4.0E-12
sp|P63133|POK8_HUMAN Endogenous retrovirus group K member 8 Pol protein OS=Homo sapiens GN=ERVK-8 PE=3 SV=1 812 1017 5.0E-12
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 820 1012 6.0E-12
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 820 1052 6.0E-12
sp|P25059|POL_BLVAU Pol polyprotein OS=Bovine leukemia virus (isolate Australian) GN=pol PE=3 SV=1 820 1011 6.0E-12
sp|Q04095|POL_RSVSA Gag-Pro-Pol polyprotein OS=Avian leukosis virus RSA GN=gag-pro-pol PE=3 SV=2 812 1048 6.0E-12
sp|P03362|POL_HTL1A Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) GN=gag-pro-pol PE=1 SV=3 820 1055 7.0E-12
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 945 1225 9.0E-12
sp|P10266|POK10_HUMAN Endogenous retrovirus group K member 10 Pol protein OS=Homo sapiens GN=ERVK-10 PE=3 SV=2 791 1017 1.0E-11
sp|O92956|POL_RSVSB Gag-Pro-Pol polyprotein OS=Rous sarcoma virus (strain Schmidt-Ruppin B) GN=gag-pro-pol PE=1 SV=2 812 1048 1.0E-11
sp|P03361|POL_BLVJ Pol polyprotein OS=Bovine leukemia virus (isolate Japanese BLV-1) GN=pol PE=3 SV=1 820 1011 2.0E-11
sp|Q9WJR5|POK19_HUMAN Endogenous retrovirus group K member 19 Pol protein OS=Homo sapiens GN=ERVK-19 PE=2 SV=2 791 965 4.0E-11
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 2 GN=gag-pro-pol PE=1 SV=4 820 1058 5.0E-11
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 881 1215 2.0E-10
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 980 1114 4.0E-10
sp|P63128|POK9_HUMAN Endogenous retrovirus group K member 9 Pol protein OS=Homo sapiens GN=ERVK-9 PE=3 SV=3 791 950 5.0E-10
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 1306 1482 6.0E-10
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 823 1115 7.0E-10
sp|Q0R5R2|POL_HTL32 Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain 2026ND) GN=gag-pro-pol PE=3 SV=3 820 1012 7.0E-10
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 825 1011 1.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 821 1052 5.0E-09
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 1333 1464 1.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 823 1052 2.0E-07
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 820 1043 4.0E-07
sp|P35956|POL_VILVK Pol polyprotein OS=Maedi visna virus (strain KV1772) GN=pol PE=1 SV=1 763 990 5.0E-07
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 1335 1464 6.0E-07
sp|P23426|POL_VILV1 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS1) GN=pol PE=3 SV=1 763 990 7.0E-07
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 1140 1230 9.0E-07
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 1345 1464 9.0E-07
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 1286 1464 1.0E-06
sp|P23427|POL_VILV2 Pol polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=pol PE=3 SV=1 763 990 1.0E-06
sp|P03370|POL_VILV Pol polyprotein OS=Maedi visna virus (strain 1514) GN=pol PE=3 SV=1 763 990 1.0E-06
sp|Q74120|POL_HV2KR Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate KR) GN=gag-pol PE=3 SV=3 808 990 2.0E-06
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 840 990 4.0E-06
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 805 1055 4.0E-06
sp|P18096|POL_HV2BE Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate BEN) GN=gag-pol PE=3 SV=4 820 990 4.0E-06
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 808 990 5.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 810 990 7.0E-06
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 798 990 7.0E-06
sp|P17757|POL_HV2D1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate D194) GN=gag-pol PE=3 SV=3 802 1055 8.0E-06
sp|P12898|DPOL_WHV4 Protein P OS=Woodchuck hepatitis B virus (isolate 7) GN=P PE=3 SV=1 880 1150 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024950
MHTAYTVASSQKPSKPKGPGSLSGPKRLVSTLEVIPTSSPASSSRDQSDTALLRSGKLVPKPTVPIHNDHGQGIL
TLISAHICTSDTNNTDTYRLFADPQSVVDPLPNVQDVLDREDFGDCAHTCMSTNDSPSLFGVDSSDDSQILGTLP
QSPPPTTLHHLTPPGDLPLNTASTSDTESESDSASDSSSDFDMGKSPIAIGTGIELSKVGGLPRVTATTLTPSIL
RDLEDYANVSYQVGKKVAPAKQLKKLAACFSNIEHMSWVLTEADLQPEGTTLSIFLDKMRQRFLPNNWELLIEAE
REAEVMHEDDTYMDWATRVKKKNNILKGTPCHLNDKRLRLFLLSHLEHGLKGVVFSATDDKGIKVTDIKDFNNWE
KEVQRLDTLRASQRASQRQLVLSIMNDNDRHRDAKGKTKGKKPNERKNENSSSDRCPPLTGDERTILYKYDGCLK
CRKVFQNHISKDCTAAWPKKDGYRAVQEPSQSDIDTWKKKPSDSRDKRSRSDQSSHATSSYPSKRAKKDVAAAIL
ESESDSSEADDVIAAIEDDGDTTDEVRGRHLYWDCSLTGPNSKSPVNTTALLDSGAHVVLIHETLVSELGLKRFP
LSDTFSVRGAMSTQRSFINEFVYIVLSSIDLSYTARPVRALIIGELSAPIILGMPFLSRNAIQINHHTRIVTDTL
QNYELLGSGSTMHTKPTKRTTCSRSRPDVKVQNTQRTTSPYRKLLVEDLKDKLRTTKMTLSPQHHTSFSDAHSVV
AAIHKRITQVIDEEVLRRLHDKIVSEFASVFATMPKVSCLPKDIEADIRLKDPLLTVKPRTYSCPRRYKEAWKKL
IDDHLEAGRIQPSASPFASPSFCIPKADPTAAPRWVNDYRELNKNTIPDNYALPKVDDVLNDCSKGKYFAVIDMT
NAFFQTRMRAKDIHKTAVTTPFGSFEWKVMPMGLRNAPAIHQRRINRALRAHIGKICQAYIDDIVIWSQTLSEHE
ANVRLILSTLQQAGLYCNLKKTKLFCTEINFLGHQISAAGIQADDRKAERIMNWPVPQNAKDVRQFLGLVRYLAV
FLPDLARYSTILNKLTDKSATTDFPGWSDSHQHAFDKIKELVLSRDCLTTIDYTAMPSKRIFVSTDASDFASGTV
LTFGETFETARPVAFESKSFKGAELNYPVHEKELFAIVRALEKWRVDLLGVPFTVLTDHRTLECFNTQHHLSRRQ
ARWMEFLQQYDFTIVYLRGEDNVAADALSRTTFASAVSEQNAFHMSPCDRFDELDISVCTTLDSALTPQAEWATM
LTQLPNDVVAPTLDIATDDELRDAILSGYANDAWCSKLLATWKQMHNVVLRGGLLFFEDRLVIPRTGNVRETIFA
LAHDSLGHFGLDKSYEALRGSFYWPGMHADLEKLYVPKCAQCQRMKSSTKKPIGPLHPLPVPDHRFEAVAIDFVG
PLPEEFGFNCILTMTDRLGADVRLVPTSMNATAVDTAQLFFHHWYCENGLPQEIVSDRDQIRHGRLEESLEESNP
CGVGIP*
Coding >AgabiH97|024950
ATGCATACAGCATACACCGTGGCTTCGTCTCAAAAGCCTTCGAAACCGAAAGGTCCAGGTTCTCTCTCTGGTCCT
AAACGTCTTGTATCTACACTGGAGGTCATTCCGACTTCATCCCCTGCGTCTTCATCGCGAGACCAGTCCGACACC
GCACTGTTACGTTCCGGAAAACTGGTTCCGAAACCTACTGTACCGATTCACAACGACCACGGTCAAGGTATTTTG
ACGCTTATATCAGCGCATATATGCACTTCTGACACAAACAACACCGACACCTACCGACTTTTTGCAGATCCACAG
AGCGTTGTTGATCCTCTACCAAACGTACAGGACGTGCTTGACCGCGAAGACTTTGGTGATTGTGCGCATACATGC
ATGTCTACAAACGATTCACCTTCCCTTTTTGGTGTAGATTCCAGTGACGATTCACAGATACTTGGAACTCTGCCG
CAGTCACCCCCACCGACTACTTTGCATCATCTCACTCCTCCTGGAGACTTGCCGTTGAACACTGCTTCCACTTCC
GACACCGAATCCGAATCCGACTCAGCCTCTGATTCATCTTCCGATTTCGACATGGGAAAATCACCTATTGCTATC
GGCACCGGCATCGAACTCTCGAAAGTTGGTGGACTACCTCGAGTCACGGCCACCACGCTCACTCCGTCTATCCTC
CGTGACCTTGAGGACTACGCGAATGTATCTTACCAGGTCGGCAAGAAAGTTGCCCCAGCGAAACAACTGAAGAAG
CTAGCGGCTTGTTTCTCGAATATCGAACACATGTCGTGGGTTTTAACGGAAGCCGATTTGCAACCTGAAGGAACT
ACGTTGAGTATTTTCTTGGACAAAATGCGTCAACGTTTCTTACCCAATAATTGGGAGCTCCTCATCGAGGCCGAG
CGTGAGGCCGAGGTCATGCATGAAGACGACACGTACATGGATTGGGCTACTCGGGTTAAAAAGAAGAACAACATT
CTTAAAGGTACCCCTTGCCACCTTAACGACAAACGCCTACGCCTTTTCTTGCTGTCCCATCTCGAGCATGGCTTG
AAGGGTGTCGTATTCTCTGCTACCGACGACAAAGGTATCAAGGTTACAGATATCAAAGACTTCAACAACTGGGAA
AAGGAGGTCCAGCGGTTGGATACTTTACGAGCTTCGCAACGTGCTTCTCAACGACAGCTTGTCTTGAGTATAATG
AACGACAATGACCGCCACCGTGATGCCAAAGGAAAGACGAAGGGGAAGAAGCCGAACGAAAGAAAGAACGAGAAT
AGCAGTTCCGATCGATGTCCGCCTCTCACTGGTGACGAACGTACCATCCTCTACAAGTATGACGGATGTTTGAAG
TGTCGTAAGGTTTTCCAAAATCACATCTCTAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGTTATCGTGCT
GTGCAGGAACCTTCCCAATCGGATATCGACACTTGGAAGAAGAAGCCATCCGATAGTCGGGATAAACGTTCGCGC
TCGGATCAGTCATCTCATGCGACTTCTTCTTATCCTAGCAAACGTGCTAAGAAAGATGTCGCGGCCGCTATATTG
GAATCAGAGAGTGACAGTTCCGAAGCCGATGATGTGATTGCTGCGATTGAGGATGACGGCGATACTACCGACGAA
GTGCGTGGCAGACATCTTTACTGGGATTGCTCACTAACGGGGCCTAACAGTAAATCTCCTGTTAATACTACGGCT
TTACTAGACAGTGGGGCACATGTTGTCCTTATTCATGAAACCCTCGTCTCTGAACTCGGACTCAAACGTTTTCCG
CTTAGCGATACCTTCTCCGTTCGTGGCGCTATGTCTACCCAACGCTCTTTCATAAATGAATTTGTTTACATTGTT
CTGTCGTCAATTGATTTGTCTTACACTGCACGTCCTGTGAGAGCTCTTATCATTGGCGAATTGTCTGCTCCAATA
ATTCTTGGAATGCCGTTTCTCTCGCGGAACGCTATCCAGATTAATCACCACACGAGGATTGTTACAGACACCTTA
CAAAACTATGAATTGCTCGGGTCTGGTAGCACAATGCATACCAAACCTACTAAACGAACCACTTGTTCTCGTTCT
CGCCCAGATGTTAAGGTGCAGAACACGCAACGTACAACTTCCCCCTACCGAAAATTACTTGTGGAGGATCTTAAA
GATAAACTGCGTACTACAAAAATGACACTCTCACCACAGCATCATACATCTTTTTCCGATGCACACAGTGTGGTT
GCTGCGATCCATAAGCGCATAACACAAGTCATTGACGAAGAGGTACTACGTCGCTTACATGACAAGATTGTCTCC
GAGTTTGCTTCTGTTTTTGCAACGATGCCAAAAGTATCTTGTCTACCGAAAGACATTGAAGCTGACATTAGACTT
AAAGATCCCCTGTTGACTGTTAAACCACGTACCTATAGCTGCCCTCGTCGCTACAAGGAAGCCTGGAAGAAACTT
ATCGATGACCACCTCGAGGCTGGTCGCATACAACCGTCTGCATCCCCTTTTGCTTCGCCATCGTTCTGCATTCCT
AAAGCCGATCCGACCGCTGCACCTCGTTGGGTAAATGACTATCGTGAACTAAACAAGAATACAATACCTGACAAT
TACGCACTACCTAAAGTCGACGATGTCTTAAACGACTGCTCAAAAGGAAAATATTTTGCAGTTATTGACATGACA
AACGCTTTTTTCCAAACTCGCATGCGAGCAAAGGACATACACAAAACAGCGGTAACAACTCCGTTTGGTTCTTTT
GAATGGAAAGTCATGCCCATGGGACTGCGTAATGCACCTGCTATCCATCAACGTCGCATTAACAGAGCTTTACGA
GCCCATATTGGAAAAATCTGTCAGGCATACATAGATGATATCGTGATTTGGTCCCAGACTTTGTCTGAACATGAA
GCTAATGTTCGTTTGATCTTGTCAACGTTACAACAGGCTGGGCTATACTGCAACTTAAAGAAAACGAAGTTGTTC
TGCACCGAAATAAATTTTCTTGGGCATCAAATCAGTGCTGCGGGCATACAGGCTGACGACCGTAAAGCTGAGCGT
ATTATGAATTGGCCTGTCCCACAAAACGCGAAAGACGTCCGTCAATTCTTGGGTTTAGTTCGCTACCTGGCTGTC
TTCTTGCCAGACCTTGCTCGCTATTCTACTATTCTCAATAAGCTTACAGACAAATCTGCCACCACGGACTTTCCG
GGCTGGAGTGACTCACATCAGCATGCTTTCGACAAAATAAAGGAACTGGTTCTGTCCCGCGACTGCCTAACGACT
ATCGATTACACCGCTATGCCGTCTAAGCGTATTTTCGTCTCCACTGACGCTTCCGACTTTGCAAGTGGGACCGTT
CTCACATTCGGCGAGACCTTCGAAACCGCTCGTCCTGTAGCTTTCGAATCCAAGTCGTTCAAAGGTGCTGAGCTC
AACTATCCTGTCCATGAAAAAGAACTGTTTGCGATTGTTAGAGCGCTCGAGAAATGGCGTGTCGACCTGCTTGGC
GTACCTTTCACGGTTCTCACTGATCATCGGACACTTGAGTGTTTCAACACACAACACCACCTGTCCCGGCGACAA
GCCAGGTGGATGGAGTTTCTACAACAGTATGACTTTACCATTGTTTACCTGCGAGGTGAAGACAATGTCGCTGCT
GATGCCCTCTCCCGGACCACATTTGCTAGTGCGGTTTCTGAACAAAATGCTTTTCATATGTCTCCCTGTGATCGT
TTCGATGAACTTGACATTTCGGTCTGTACAACGTTGGACAGCGCACTCACACCTCAGGCTGAGTGGGCAACCATG
CTCACCCAGCTCCCGAATGACGTAGTTGCCCCCACACTTGACATTGCTACAGATGATGAACTCCGTGACGCTATC
CTCTCCGGCTATGCAAACGACGCTTGGTGTTCCAAATTGCTAGCCACTTGGAAGCAAATGCACAACGTAGTGTTA
CGAGGCGGCTTACTTTTTTTTGAAGACCGTCTTGTCATCCCTCGGACCGGGAACGTTCGAGAAACCATATTCGCC
TTGGCTCACGATTCTTTGGGTCATTTTGGACTTGATAAATCGTACGAGGCTTTGCGGGGTTCATTTTACTGGCCT
GGGATGCATGCCGACCTGGAGAAGTTGTATGTCCCTAAATGTGCTCAATGTCAACGGATGAAATCCTCCACAAAG
AAACCTATCGGTCCCTTACATCCCCTGCCCGTACCGGACCATCGTTTTGAAGCGGTCGCTATCGATTTTGTTGGC
CCATTGCCTGAAGAGTTTGGATTCAATTGTATCCTCACCATGACTGACCGCCTCGGGGCCGATGTTCGGCTTGTT
CCAACGTCAATGAATGCCACTGCTGTCGACACAGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAACGGCTTA
CCTCAGGAAATTGTATCTGATCGAGACCAGATTCGTCACGGCAGATTGGAGGAATCACTCGAGGAGAGCAACCCA
TGCGGAGTTGGAATCCCGTGA
Transcript >AgabiH97|024950
ATGCATACAGCATACACCGTGGCTTCGTCTCAAAAGCCTTCGAAACCGAAAGGTCCAGGTTCTCTCTCTGGTCCT
AAACGTCTTGTATCTACACTGGAGGTCATTCCGACTTCATCCCCTGCGTCTTCATCGCGAGACCAGTCCGACACC
GCACTGTTACGTTCCGGAAAACTGGTTCCGAAACCTACTGTACCGATTCACAACGACCACGGTCAAGGTATTTTG
ACGCTTATATCAGCGCATATATGCACTTCTGACACAAACAACACCGACACCTACCGACTTTTTGCAGATCCACAG
AGCGTTGTTGATCCTCTACCAAACGTACAGGACGTGCTTGACCGCGAAGACTTTGGTGATTGTGCGCATACATGC
ATGTCTACAAACGATTCACCTTCCCTTTTTGGTGTAGATTCCAGTGACGATTCACAGATACTTGGAACTCTGCCG
CAGTCACCCCCACCGACTACTTTGCATCATCTCACTCCTCCTGGAGACTTGCCGTTGAACACTGCTTCCACTTCC
GACACCGAATCCGAATCCGACTCAGCCTCTGATTCATCTTCCGATTTCGACATGGGAAAATCACCTATTGCTATC
GGCACCGGCATCGAACTCTCGAAAGTTGGTGGACTACCTCGAGTCACGGCCACCACGCTCACTCCGTCTATCCTC
CGTGACCTTGAGGACTACGCGAATGTATCTTACCAGGTCGGCAAGAAAGTTGCCCCAGCGAAACAACTGAAGAAG
CTAGCGGCTTGTTTCTCGAATATCGAACACATGTCGTGGGTTTTAACGGAAGCCGATTTGCAACCTGAAGGAACT
ACGTTGAGTATTTTCTTGGACAAAATGCGTCAACGTTTCTTACCCAATAATTGGGAGCTCCTCATCGAGGCCGAG
CGTGAGGCCGAGGTCATGCATGAAGACGACACGTACATGGATTGGGCTACTCGGGTTAAAAAGAAGAACAACATT
CTTAAAGGTACCCCTTGCCACCTTAACGACAAACGCCTACGCCTTTTCTTGCTGTCCCATCTCGAGCATGGCTTG
AAGGGTGTCGTATTCTCTGCTACCGACGACAAAGGTATCAAGGTTACAGATATCAAAGACTTCAACAACTGGGAA
AAGGAGGTCCAGCGGTTGGATACTTTACGAGCTTCGCAACGTGCTTCTCAACGACAGCTTGTCTTGAGTATAATG
AACGACAATGACCGCCACCGTGATGCCAAAGGAAAGACGAAGGGGAAGAAGCCGAACGAAAGAAAGAACGAGAAT
AGCAGTTCCGATCGATGTCCGCCTCTCACTGGTGACGAACGTACCATCCTCTACAAGTATGACGGATGTTTGAAG
TGTCGTAAGGTTTTCCAAAATCACATCTCTAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGTTATCGTGCT
GTGCAGGAACCTTCCCAATCGGATATCGACACTTGGAAGAAGAAGCCATCCGATAGTCGGGATAAACGTTCGCGC
TCGGATCAGTCATCTCATGCGACTTCTTCTTATCCTAGCAAACGTGCTAAGAAAGATGTCGCGGCCGCTATATTG
GAATCAGAGAGTGACAGTTCCGAAGCCGATGATGTGATTGCTGCGATTGAGGATGACGGCGATACTACCGACGAA
GTGCGTGGCAGACATCTTTACTGGGATTGCTCACTAACGGGGCCTAACAGTAAATCTCCTGTTAATACTACGGCT
TTACTAGACAGTGGGGCACATGTTGTCCTTATTCATGAAACCCTCGTCTCTGAACTCGGACTCAAACGTTTTCCG
CTTAGCGATACCTTCTCCGTTCGTGGCGCTATGTCTACCCAACGCTCTTTCATAAATGAATTTGTTTACATTGTT
CTGTCGTCAATTGATTTGTCTTACACTGCACGTCCTGTGAGAGCTCTTATCATTGGCGAATTGTCTGCTCCAATA
ATTCTTGGAATGCCGTTTCTCTCGCGGAACGCTATCCAGATTAATCACCACACGAGGATTGTTACAGACACCTTA
CAAAACTATGAATTGCTCGGGTCTGGTAGCACAATGCATACCAAACCTACTAAACGAACCACTTGTTCTCGTTCT
CGCCCAGATGTTAAGGTGCAGAACACGCAACGTACAACTTCCCCCTACCGAAAATTACTTGTGGAGGATCTTAAA
GATAAACTGCGTACTACAAAAATGACACTCTCACCACAGCATCATACATCTTTTTCCGATGCACACAGTGTGGTT
GCTGCGATCCATAAGCGCATAACACAAGTCATTGACGAAGAGGTACTACGTCGCTTACATGACAAGATTGTCTCC
GAGTTTGCTTCTGTTTTTGCAACGATGCCAAAAGTATCTTGTCTACCGAAAGACATTGAAGCTGACATTAGACTT
AAAGATCCCCTGTTGACTGTTAAACCACGTACCTATAGCTGCCCTCGTCGCTACAAGGAAGCCTGGAAGAAACTT
ATCGATGACCACCTCGAGGCTGGTCGCATACAACCGTCTGCATCCCCTTTTGCTTCGCCATCGTTCTGCATTCCT
AAAGCCGATCCGACCGCTGCACCTCGTTGGGTAAATGACTATCGTGAACTAAACAAGAATACAATACCTGACAAT
TACGCACTACCTAAAGTCGACGATGTCTTAAACGACTGCTCAAAAGGAAAATATTTTGCAGTTATTGACATGACA
AACGCTTTTTTCCAAACTCGCATGCGAGCAAAGGACATACACAAAACAGCGGTAACAACTCCGTTTGGTTCTTTT
GAATGGAAAGTCATGCCCATGGGACTGCGTAATGCACCTGCTATCCATCAACGTCGCATTAACAGAGCTTTACGA
GCCCATATTGGAAAAATCTGTCAGGCATACATAGATGATATCGTGATTTGGTCCCAGACTTTGTCTGAACATGAA
GCTAATGTTCGTTTGATCTTGTCAACGTTACAACAGGCTGGGCTATACTGCAACTTAAAGAAAACGAAGTTGTTC
TGCACCGAAATAAATTTTCTTGGGCATCAAATCAGTGCTGCGGGCATACAGGCTGACGACCGTAAAGCTGAGCGT
ATTATGAATTGGCCTGTCCCACAAAACGCGAAAGACGTCCGTCAATTCTTGGGTTTAGTTCGCTACCTGGCTGTC
TTCTTGCCAGACCTTGCTCGCTATTCTACTATTCTCAATAAGCTTACAGACAAATCTGCCACCACGGACTTTCCG
GGCTGGAGTGACTCACATCAGCATGCTTTCGACAAAATAAAGGAACTGGTTCTGTCCCGCGACTGCCTAACGACT
ATCGATTACACCGCTATGCCGTCTAAGCGTATTTTCGTCTCCACTGACGCTTCCGACTTTGCAAGTGGGACCGTT
CTCACATTCGGCGAGACCTTCGAAACCGCTCGTCCTGTAGCTTTCGAATCCAAGTCGTTCAAAGGTGCTGAGCTC
AACTATCCTGTCCATGAAAAAGAACTGTTTGCGATTGTTAGAGCGCTCGAGAAATGGCGTGTCGACCTGCTTGGC
GTACCTTTCACGGTTCTCACTGATCATCGGACACTTGAGTGTTTCAACACACAACACCACCTGTCCCGGCGACAA
GCCAGGTGGATGGAGTTTCTACAACAGTATGACTTTACCATTGTTTACCTGCGAGGTGAAGACAATGTCGCTGCT
GATGCCCTCTCCCGGACCACATTTGCTAGTGCGGTTTCTGAACAAAATGCTTTTCATATGTCTCCCTGTGATCGT
TTCGATGAACTTGACATTTCGGTCTGTACAACGTTGGACAGCGCACTCACACCTCAGGCTGAGTGGGCAACCATG
CTCACCCAGCTCCCGAATGACGTAGTTGCCCCCACACTTGACATTGCTACAGATGATGAACTCCGTGACGCTATC
CTCTCCGGCTATGCAAACGACGCTTGGTGTTCCAAATTGCTAGCCACTTGGAAGCAAATGCACAACGTAGTGTTA
CGAGGCGGCTTACTTTTTTTTGAAGACCGTCTTGTCATCCCTCGGACCGGGAACGTTCGAGAAACCATATTCGCC
TTGGCTCACGATTCTTTGGGTCATTTTGGACTTGATAAATCGTACGAGGCTTTGCGGGGTTCATTTTACTGGCCT
GGGATGCATGCCGACCTGGAGAAGTTGTATGTCCCTAAATGTGCTCAATGTCAACGGATGAAATCCTCCACAAAG
AAACCTATCGGTCCCTTACATCCCCTGCCCGTACCGGACCATCGTTTTGAAGCGGTCGCTATCGATTTTGTTGGC
CCATTGCCTGAAGAGTTTGGATTCAATTGTATCCTCACCATGACTGACCGCCTCGGGGCCGATGTTCGGCTTGTT
CCAACGTCAATGAATGCCACTGCTGTCGACACAGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAACGGCTTA
CCTCAGGAAATTGTATCTGATCGAGACCAGATTCGTCACGGCAGATTGGAGGAATCACTCGAGGAGAGCAACCCA
TGCGGAGTTGGAATCCCGTGA
Gene >AgabiH97|024950
ATGCATACAGCATACACCGTGGCTTCGTCTCAAAAGCCTTCGAAACCGAAAGGTCCAGGTTCTCTCTCTGGTCCT
AAACGTCTTGTATCTACACTGGAGGTCATTCCGACTTCATCCCCTGCGTCTTCATCGCGAGACCAGTCCGACACC
GCACTGTTACGTTCCGGAAAACTGGTTCCGAAACCTACTGTACCGATTCACAACGACCACGGTCAAGGTATTTTG
ACGCTTATATCAGCGCATATATGCACTTCTGACACAAACAACACCGACACCTACCGACTTTTTGCAGATCCACAG
AGCGTTGTTGATCCTCTACCAAACGTACAGGACGTGCTTGACCGCGAAGACTTTGGTGATTGTGCGCATACATGC
ATGTCTACAAACGATTCACCTTCCCTTTTTGGTGTAGATTCCAGTGACGATTCACAGATACTTGGAACTCTGCCG
CAGTCACCCCCACCGACTACTTTGCATCATCTCACTCCTCCTGGAGACTTGCCGTTGAACACTGCTTCCACTTCC
GACACCGAATCCGAATCCGACTCAGCCTCTGATTCATCTTCCGATTTCGACATGGGAAAATCACCTATTGCTATC
GGCACCGGCATCGAACTCTCGAAAGTTGGTGGACTACCTCGAGTCACGGCCACCACGCTCACTCCGTCTATCCTC
CGTGACCTTGAGGACTACGCGAATGTATCTTACCAGGTCGGCAAGAAAGTTGCCCCAGCGAAACAACTGAAGAAG
CTAGCGGCTTGTTTCTCGAATATCGAACACATGTCGTGGGTTTTAACGGAAGCCGATTTGCAACCTGAAGGAACT
ACGTTGAGTATTTTCTTGGACAAAATGCGTCAACGTTTCTTACCCAATAATTGGGAGCTCCTCATCGAGGCCGAG
CGTGAGGCCGAGGTCATGCATGAAGACGACACGTACATGGATTGGGCTACTCGGGTTAAAAAGAAGAACAACATT
CTTAAAGGTACCCCTTGCCACCTTAACGACAAACGCCTACGCCTTTTCTTGCTGTCCCATCTCGAGCATGGCTTG
AAGGGTGTCGTATTCTCTGCTACCGACGACAAAGGTATCAAGGTTACAGATATCAAAGACTTCAACAACTGGGAA
AAGGAGGTCCAGCGGTTGGATACTTTACGAGCTTCGCAACGTGCTTCTCAACGACAGCTTGTCTTGAGTATAATG
AACGACAATGACCGCCACCGTGATGCCAAAGGAAAGACGAAGGGGAAGAAGCCGAACGAAAGAAAGAACGAGAAT
AGCAGTTCCGATCGATGTCCGCCTCTCACTGGTGACGAACGTACCATCCTCTACAAGTATGACGGATGTTTGAAG
TGTCGTAAGGTTTTCCAAAATCACATCTCTAAGGACTGCACAGCTGCCTGGCCAAAGAAGGATGGTTATCGTGCT
GTGCAGGAACCTTCCCAATCGGATATCGACACTTGGAAGAAGAAGCCATCCGATAGTCGGGATAAACGTTCGCGC
TCGGATCAGTCATCTCATGCGACTTCTTCTTATCCTAGCAAACGTGCTAAGAAAGATGTCGCGGCCGCTATATTG
GAATCAGAGAGTGACAGTTCCGAAGCCGATGATGTGATTGCTGCGATTGAGGATGACGGCGATACTACCGACGAA
GTGCGTGGCAGACATCTTTACTGGGATTGCTCACTAACGGGGCCTAACAGTAAATCTCCTGTTAATACTACGGCT
TTACTAGACAGTGGGGCACATGTTGTCCTTATTCATGAAACCCTCGTCTCTGAACTCGGACTCAAACGTTTTCCG
CTTAGCGATACCTTCTCCGTTCGTGGCGCTATGTCTACCCAACGCTCTTTCATAAATGAATTTGTTTACATTGTT
CTGTCGTCAATTGATTTGTCTTACACTGCACGTCCTGTGAGAGCTCTTATCATTGGCGAATTGTCTGCTCCAATA
ATTCTTGGAATGCCGTTTCTCTCGCGGAACGCTATCCAGATTAATCACCACACGAGGATTGTTACAGACACCTTA
CAAAACTATGAATTGCTCGGGTCTGGTAGCACAATGCATACCAAACCTACTAAACGAACCACTTGTTCTCGTTCT
CGCCCAGATGTTAAGGTGCAGAACACGCAACGTACAACTTCCCCCTACCGAAAATTACTTGTGGAGGATCTTAAA
GATAAACTGCGTACTACAAAAATGACACTCTCACCACAGCATCATACATCTTTTTCCGATGCACACAGTGTGGTT
GCTGCGATCCATAAGCGCATAACACAAGTCATTGACGAAGAGGTACTACGTCGCTTACATGACAAGATTGTCTCC
GAGTTTGCTTCTGTTTTTGCAACGATGCCAAAAGTATCTTGTCTACCGAAAGACATTGAAGCTGACATTAGACTT
AAAGATCCCCTGTTGACTGTTAAACCACGTACCTATAGCTGCCCTCGTCGCTACAAGGAAGCCTGGAAGAAACTT
ATCGATGACCACCTCGAGGCTGGTCGCATACAACCGTCTGCATCCCCTTTTGCTTCGCCATCGTTCTGCATTCCT
AAAGCCGATCCGACCGCTGCACCTCGTTGGGTAAATGACTATCGTGAACTAAACAAGAATACAATACCTGACAAT
TACGCACTACCTAAAGTCGACGATGTCTTAAACGACTGCTCAAAAGGAAAATATTTTGCAGTTATTGACATGACA
AACGCTTTTTTCCAAACTCGCATGCGAGCAAAGGACATACACAAAACAGCGGTAACAACTCCGTTTGGTTCTTTT
GAATGGAAAGTCATGCCCATGGGACTGCGTAATGCACCTGCTATCCATCAACGTCGCATTAACAGAGCTTTACGA
GCCCATATTGGAAAAATCTGTCAGGCATACATAGATGATATCGTGATTTGGTCCCAGACTTTGTCTGAACATGAA
GCTAATGTTCGTTTGATCTTGTCAACGTTACAACAGGCTGGGCTATACTGCAACTTAAAGAAAACGAAGTTGTTC
TGCACCGAAATAAATTTTCTTGGGCATCAAATCAGTGCTGCGGGCATACAGGCTGACGACCGTAAAGCTGAGCGT
ATTATGAATTGGCCTGTCCCACAAAACGCGAAAGACGTCCGTCAATTCTTGGGTTTAGTTCGCTACCTGGCTGTC
TTCTTGCCAGACCTTGCTCGCTATTCTACTATTCTCAATAAGCTTACAGACAAATCTGCCACCACGGACTTTCCG
GGCTGGAGTGACTCACATCAGCATGCTTTCGACAAAATAAAGGAACTGGTTCTGTCCCGCGACTGCCTAACGACT
ATCGATTACACCGCTATGCCGTCTAAGCGTATTTTCGTCTCCACTGACGCTTCCGACTTTGCAAGTGGGACCGTT
CTCACATTCGGCGAGACCTTCGAAACCGCTCGTCCTGTAGCTTTCGAATCCAAGTCGTTCAAAGGTGCTGAGCTC
AACTATCCTGTCCATGAAAAAGAACTGTTTGCGATTGTTAGAGCGCTCGAGAAATGGCGTGTCGACCTGCTTGGC
GTACCTTTCACGGTTCTCACTGATCATCGGACACTTGAGTGTTTCAACACACAACACCACCTGTCCCGGCGACAA
GCCAGGTGGATGGAGTTTCTACAACAGTATGACTTTACCATTGTTTACCTGCGAGGTGAAGACAATGTCGCTGCT
GATGCCCTCTCCCGGACCACATTTGCTAGTGCGGTTTCTGAACAAAATGCTTTTCATATGTCTCCCTGTGATCGT
TTCGATGAACTTGACATTTCGGTCTGTACAACGTTGGACAGCGCACTCACACCTCAGGCTGAGTGGGCAACCATG
CTCACCCAGCTCCCGAATGACGTAGTTGCCCCCACACTTGACATTGCTACAGATGATGAACTCCGTGACGCTATC
CTCTCCGGCTATGCAAACGACGCTTGGTGTTCCAAATTGCTAGCCACTTGGAAGCAAATGCACAACGTAGTGTTA
CGAGGCGGCTTACTTTTTTTTGAAGACCGTCTTGTCATCCCTCGGACCGGGAACGTTCGAGAAACCATATTCGCC
TTGGCTCACGATTCTTTGGGTCATTTTGGACTTGATAAATCGTACGAGGCTTTGCGGGGTTCATTTTACTGGCCT
GGGATGCATGCCGACCTGGAGAAGTTGTATGTCCCTAAATGTGCTCAATGTCAACGGATGAAATCCTCCACAAAG
AAACCTATCGGTCCCTTACATCCCCTGCCCGTACCGGACCATCGTTTTGAAGCGGTCGCTATCGATTTTGTTGGC
CCATTGCCTGAAGAGTTTGGATTCAATTGTATCCTCACCATGACTGACCGCCTCGGGGCCGATGTTCGGCTTGTT
CCAACGTCAATGAATGCCACTGCTGTCGACACAGCTCAGCTCTTTTTCCACCACTGGTATTGCGAAAACGGCTTA
CCTCAGGAAATTGTATCTGATCGAGACCAGATTCGTCACGGCAGATTGGAGGAATCACTCGAGGAGAGCAACCCA
TGCGGAGTTGGAATCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail