Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024880
Gene name
Locationscaffold_11:841495..844481
Strand-
Gene length (bp)2986
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 1.3E-07 71 135
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 1.6E-05 760 827

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40566|YIS7_YEAST Uncharacterized glycosyl hydrolase YIR007W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR007W PE=1 SV=1 6 604 4.0E-127

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024880
MSSPDADLLSTAQFSFVDCHGRKIFLRGVNLSGSSKSPLDQPSHLLSHFWETAEAGGESSIGQPLNLEDGSADEH
LARLRGWGFNLLRFPVTWEALERAGPKKYDYEYMDYIVRVLVKCKQYGFRVYMDPHQDTWSRFSGGSGAPFWTLP
ACGIDPYHISATQAALLHSEYPLPHNADPSTFPAMIWGTNYGRLFSLTLFTLFFAGRTFAPNCIIDDMNIQDYLQ
SHYISAFGELADRIRQADEEEGTGLRDACIIGWDTLNEPAEGLVSWDDLNKLPMKQGTTLKKGTTPTPAQSLRLG
MGQPQTVECWDFGTFGPRRTGTVDVNPKGRKVWAEIDQCNGGELPDGTHPRWGWKRDISKWPLGTCVWALHGVWD
IQSGYMLQPDYFKYHPTTGIEVEFMTDFWLPHFKAYGERIRSSHPNAILFVQPPVFALPPRVDEEILKGRCAYTG
HYYDGLTLITKHWNWFNADSLGVLRGKYRYPLQAVKIGEKAIRKSLMEQIAMLKDDARLISTPCSLLPSTSPHNQ
YPTVIGEIGTPFDMDDKHAYFESKGDYKNQEKALDASLNACDGSNNVAYTVWTYIARGHSHQWGDAWNGEDLSLW
SCDDMRCTYGNGDAGDAGCGGVSNGVESGLRARAKRWSGSEKAREAERKAKSESQARLLSGGGGRSTALLESANA
SMLSLNTISTRGTNLVPPLPGAGDEQEQLPTAPSILPTTSETSETSTATIISPSSSSLLLSSACHDDDPFDFLTD
GARAVRAFCRPRPVKVLGDVVDTRFDIGKAEFKCVIRVPPSTSTTSRDGQDEITTEFFIPLVHFASHKLLENSKV
RWYGDVKSKKDKTMEMDPPKEYGYRSAEEDEMEEGRAVKKRVLEGIENREDLFDIEVKVSHGRWNIKGQTLYWSY
NQNLEVEEEMVIEVKRRGGAIKVRQGGWVEVPDTASLRERKKSWLCDCTDGCIIM*
Coding >AgabiH97|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTCGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTCCATTGGTCAACCACTAAATCTGGAAGATGGCTCAGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCCAAAAAATACGATTATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGC
GTGTACATGGACCCGCACCAGGACACATGGTCTCGTTTTTCTGGTGGCTCGGGAGCTCCCTTTTGGACGTTACCC
GCGTGCGGTATCGACCCCTACCACATCTCTGCTACCCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCAC
AACGCCGACCCGTCAACTTTCCCCGCTATGATTTGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTC
ACCCTCTTCTTCGCTGGCCGAACATTCGCACCCAATTGTATCATTGACGATATGAACATTCAGGACTATCTGCAA
TCACACTACATCTCTGCTTTTGGTGAACTAGCAGACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGCCTA
CGAGATGCATGCATCATTGGTTGGGATACTCTCAATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAAC
AAGCTCCCGATGAAACAGGGTACTACTCTAAAAAAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGC
ATGGGTCAACCTCAGACCGTCGAGTGTTGGGATTTCGGCACTTTTGGACCGAGGCGTACCGGGACCGTTGACGTC
AATCCTAAAGGAAGGAAAGTTTGGGCCGAAATAGACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCT
CGGTGGGGTTGGAAACGCGACATTTCGAAATGGCCTCTGGGCACTTGTGTATGGGCGTTGCATGGTGTTTGGGAC
ATACAATCTGGCTACATGCTCCAACCAGATTATTTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATG
ACTGACTTTTGGCTACCGCATTTCAAAGCTTATGGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTT
GTTCAGCCCCCGGTATTCGCGCTACCGCCACGGGTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGG
CATTATTATGATGGTCTGACGCTTATAACCAAACATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGA
GGCAAATATCGATACCCTCTACAAGCTGTAAAGATTGGTGAAAAAGCGATCCGGAAGAGCTTGATGGAGCAGATT
GCGATGCTCAAAGACGATGCGAGACTTATCTCTACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAA
TATCCCACCGTCATTGGGGAAATTGGTACTCCTTTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGC
GATTACAAGAATCAAGAGAAGGCGTTAGATGCATCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACG
GTTTGGACCTACATTGCGAGAGGACATTCACATCAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGG
AGTTGTGATGATATGCGGTGTACGTATGGCAACGGTGATGCCGGTGATGCCGGTTGTGGTGGTGTATCGAATGGA
GTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAGATGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCG
AAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGGTGGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCC
TCAATGTTGAGCCTTAATACGATCTCAACGAGAGGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAA
CAGGAACAACTGCCAACGGCACCGTCAATACTTCCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATA
ATTTCACCATCTTCCTCTTCCCTCTTACTTTCGTCTGCATGTCATGACGATGATCCGTTTGACTTCCTGACGGAT
GGCGCGAGAGCTGTCCGAGCTTTCTGTCGCCCTAGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAGATTT
GACATTGGCAAAGCAGAATTCAAATGTGTTATTCGGGTTCCGCCCAGTACTTCAACTACGTCACGCGACGGACAA
GACGAAATTACAACGGAGTTTTTTATACCCCTGGTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTG
AGGTGGTATGGAGATGTGAAGTCGAAGAAGGACAAGACGATGGAGATGGACCCACCGAAGGAGTACGGCTACAGA
AGTGCTGAGGAGGACGAGATGGAGGAAGGTAGAGCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAAATCGCGAA
GACCTTTTCGATATTGAAGTCAAAGTATCTCATGGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATAC
AACCAGAATCTAGAGGTGGAAGAGGAAATGGTGATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAA
GGAGGTTGGGTTGAAGTTCCGGATACGGCAAGCTTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGAT
GGGTGTATCATTATGTAG
Transcript >AgabiH97|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTCGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTCCATTGGTCAACCACTAAATCTGGAAGATGGCTCAGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCCAAAAAATACGATTATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGC
GTGTACATGGACCCGCACCAGGACACATGGTCTCGTTTTTCTGGTGGCTCGGGAGCTCCCTTTTGGACGTTACCC
GCGTGCGGTATCGACCCCTACCACATCTCTGCTACCCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCAC
AACGCCGACCCGTCAACTTTCCCCGCTATGATTTGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTC
ACCCTCTTCTTCGCTGGCCGAACATTCGCACCCAATTGTATCATTGACGATATGAACATTCAGGACTATCTGCAA
TCACACTACATCTCTGCTTTTGGTGAACTAGCAGACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGCCTA
CGAGATGCATGCATCATTGGTTGGGATACTCTCAATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAAC
AAGCTCCCGATGAAACAGGGTACTACTCTAAAAAAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGC
ATGGGTCAACCTCAGACCGTCGAGTGTTGGGATTTCGGCACTTTTGGACCGAGGCGTACCGGGACCGTTGACGTC
AATCCTAAAGGAAGGAAAGTTTGGGCCGAAATAGACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCT
CGGTGGGGTTGGAAACGCGACATTTCGAAATGGCCTCTGGGCACTTGTGTATGGGCGTTGCATGGTGTTTGGGAC
ATACAATCTGGCTACATGCTCCAACCAGATTATTTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATG
ACTGACTTTTGGCTACCGCATTTCAAAGCTTATGGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTT
GTTCAGCCCCCGGTATTCGCGCTACCGCCACGGGTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGG
CATTATTATGATGGTCTGACGCTTATAACCAAACATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGA
GGCAAATATCGATACCCTCTACAAGCTGTAAAGATTGGTGAAAAAGCGATCCGGAAGAGCTTGATGGAGCAGATT
GCGATGCTCAAAGACGATGCGAGACTTATCTCTACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAA
TATCCCACCGTCATTGGGGAAATTGGTACTCCTTTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGC
GATTACAAGAATCAAGAGAAGGCGTTAGATGCATCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACG
GTTTGGACCTACATTGCGAGAGGACATTCACATCAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGG
AGTTGTGATGATATGCGGTGTACGTATGGCAACGGTGATGCCGGTGATGCCGGTTGTGGTGGTGTATCGAATGGA
GTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAGATGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCG
AAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGGTGGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCC
TCAATGTTGAGCCTTAATACGATCTCAACGAGAGGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAA
CAGGAACAACTGCCAACGGCACCGTCAATACTTCCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATA
ATTTCACCATCTTCCTCTTCCCTCTTACTTTCGTCTGCATGTCATGACGATGATCCGTTTGACTTCCTGACGGAT
GGCGCGAGAGCTGTCCGAGCTTTCTGTCGCCCTAGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAGATTT
GACATTGGCAAAGCAGAATTCAAATGTGTTATTCGGGTTCCGCCCAGTACTTCAACTACGTCACGCGACGGACAA
GACGAAATTACAACGGAGTTTTTTATACCCCTGGTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTG
AGGTGGTATGGAGATGTGAAGTCGAAGAAGGACAAGACGATGGAGATGGACCCACCGAAGGAGTACGGCTACAGA
AGTGCTGAGGAGGACGAGATGGAGGAAGGTAGAGCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAAATCGCGAA
GACCTTTTCGATATTGAAGTCAAAGTATCTCATGGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATAC
AACCAGAATCTAGAGGTGGAAGAGGAAATGGTGATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAA
GGAGGTTGGGTTGAAGTTCCGGATACGGCAAGCTTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGAT
GGGTGTATCATTATGTAG
Gene >AgabiH97|024880
ATGTCGTCGCCTGATGCAGACCTGCTCAGCACGGCTCAGTTCTCCTTCGTCGACTGCCATGGCCGCAAAATCTTC
CTCAGAGGCGTAAACCTTTCAGGCTCGAGCAAATCTCCCCTGGACCAGCCATCTCATCTCCTCAGCCACTTTTGG
GAAACCGCAGAAGCTGGAGGGGAGTCTTCCATTGGTCAACCACTAAATCTGGAAGATGGCTCAGCTGATGAACAC
CTCGCTCGACTGCGTGGTTGGGGTTTCAATCTCCTGCGTTTCCCGGTAACTTGGGAAGCGTTGGAACGTGCCGGG
CCGTGAGTGTCTTATTCCTCTCTTTATATCTTTTCCCTCATCTCAAAATGTTGTATTTTCAGCAAAAAATACGAT
TATGAATATATGGATTATATTGTCCGGGTCTTGGTCAAATGCAAACAGTACGGCTTCCGCGTGTACATGGACCCG
CACCAGGACACAGTCAGTTATCTCTCTATTCATTTTGCTCTATTTTCTGAGACATTCTTGTCATTCACAGTGGTC
TCGTTTTTCTGGTGGCTCGGGAGCTCCCTTTTGGACGTTACCCGCGTGCGGTATCGACCCCTACCACATCTCTGC
TACCCAAGCAGCACTGCTGCATTCCGAATATCCATTACCTCACAACGCCGACCCGTCAACTTTCCCCGCTATGAT
TTGGGGAACAAACTACGGCCGTCTTTTTTCACTCACCCTCTTCACCCTCTTCTTCGCTGGCCGAACATTCGCACC
CAATTGTATCATTGACGATATGAACATTCAGGACTATCTGCAATCACACTACATCTCTGCTTTTGGTGAACTAGC
AGACAGGATCCGACAGGCTGACGAAGAGGAAGGTACCGGCCTACGAGATGCATGCATCATTGGTTGGGATACTCT
CAATGAACCGGCTGAAGGCCTCGTTTCCTGGGACGATCTGAACAAGCTCCCGATGAAACAGGGTACTACTCTAAA
AAAAGGTACCACACCCACTCCGGCTCAGTCGCTTCGCCTCGGCATGGGTCAACCTCAGACCGTCGAGTGTTGGGA
TTTCGGCACTTTTGGACCGAGGCGTACCGGGACCGTTGACGTCAATCCTAAAGGAAGGAAAGTTTGGGCCGAAAT
AGACCAATGCAATGGTGGAGAATTGCCCGATGGTACACACCCTCGGTGGGGTTGGAAACGCGACATTTCGAAATG
GCCTCTGGGCACTTGTGTATGGGCGTTGCATGGTGTTTGGGACATACAATCTGGCTACATGCTCCAACCAGATTA
TTTCAAATATCATCCTACTACGGGTATCGAAGTCGAGTTTATGACTGACTTTTGGCTACCGCATTTCAAAGCTTA
TGGAGAGCGAATACGATCATCCCATCCCAACGCCATCTTATTTGTTCAGCCCCCGGTATTCGCGCTACCGCCACG
GGTGGATGAAGAAATTCTGAAAGGAAGGTGTGCGTACACAGGGCATTATTATGATGGTCTGACGCTTATAACCAA
ACATTGGAATTGGTTCAATGCGGATTCGTTGGGCGTCTTACGAGGCAAATATCGATACCCTCTACAAGCTGTAAA
GATTGGTGAAAAAGCGATCCGGAAGAGCTTGATGGAGCAGATTGCGATGCTCAAAGACGATGCGAGACTTATCTC
TACCCCATGTTCCTTGCTCCCTTCAACATCTCCACACAATCAATATCCCACCGTCATTGGGGAAATTGGTACTCC
TTTCGACATGGATGACAAGCATGCTTATTTTGAATCCAAAGGCGATTACAAGAATCAAGAGAAGGCGTTAGATGC
ATCGCTTAACGCATGTGATGGGTCTAACAATGTTGCATATACGGTTTGGACCTACATTGCGAGAGGACATTCACA
TCAATGGGGAGATGCTTGGAATGGAGAGGACCTGAGTCTATGGAGTTGTGATGATATGCGGTGTACGTATGGCAA
CGGTGATGCCGGTGATGCCGGTTGTGGTGGTGTATCGAATGGAGTTGAGAGTGGGTTGAGGGCGAGAGCGAAGAG
ATGGAGTGGCAGTGAGAAGGCACGTGAGGCAGAAAGGAAGGCGAAGAGTGAAAGTCAAGCTAGGCTGCTTAGTGG
TGGAGGAGGAAGGAGCACGGCTCTGCTGGAGAGTGCGAATGCCTCAATGTTGAGCCTTAATACGATCTCAACGAG
AGGGACGAACTTAGTCCCTCCCCTTCCTGGTGCTGGTGACGAACAGGAACAACTGCCAACGGCACCGTCAATACT
TCCTACGACATCAGAAACCTCAGAAACCTCAACAGCAACGATAATTTCACCATCTTCCTCTTCCCTCTTACTTTC
GTCTGCATGTCATGACGATGATCCGTTTGACTTCCTGACGGATGGCGCGAGAGCTGTCCGAGCTTTCTGTCGCCC
TAGACCGGTGAAGGTTTTAGGAGACGTGGTGGACACCAGATTTGACATTGGCAAAGCAGAATTCAAATGTGTTAT
TCGGGTTCCGCCCAGTACTTCAACTACGTCACGCGACGGACAAGACGAAATTACAACGGAGTTTTTTATACCCCT
GGTACATTTTGCAAGTCACAAACTATTAGAAAATTCCAAAGTGAGGTGGTATGGAGATGTGAAGTCGAAGAAGGA
CAAGACGATGGAGATGGACCCACCGAAGGAGTACGGCTACAGAAGTGCTGAGGAGGACGAGATGGAGGAAGGTAG
AGCCGTGAAGAAGAGAGTTTTGGAAGGAATCGAAAATCGCGAAGACCTTTTCGATATTGAAGTCAAAGTATCTCA
TGGACGATGGAATATCAAAGGTCAAACACTATACTGGTCATACAACCAGAATCTAGAGGTGGAAGAGGAAATGGT
GATTGAGGTGAAGAGACGAGGAGGCGCTATCAAGGTTCGACAAGGAGGTTGGGTTGAAGTTCCGGATACGGCAAG
CTTGAGAGAGCGGAAGAAGAGTTGGTTGTGCGATTGCACGGATGGGTGTATCATTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail