Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024870
Gene name
Locationscaffold_11:838483..840140
Strand-
Gene length (bp)1657
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 2.2E-13 282 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12091|DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP1 PE=1 SV=1 281 382 3.0E-29
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 266 382 4.0E-23
sp|Q17QC0|PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3 274 384 1.0E-21
sp|Q95250|PGRC1_PIG Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3 274 384 3.0E-21
sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4 274 384 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12091|DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP1 PE=1 SV=1 281 382 3.0E-29
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 266 382 4.0E-23
sp|Q17QC0|PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3 274 384 1.0E-21
sp|Q95250|PGRC1_PIG Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3 274 384 3.0E-21
sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4 274 384 3.0E-21
sp|Q5RED0|PGRC1_PONAB Membrane-associated progesterone receptor component 1 OS=Pongo abelii GN=PGRMC1 PE=2 SV=3 274 384 3.0E-20
sp|P70580|PGRC1_RAT Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus GN=Pgrmc1 PE=1 SV=3 281 384 3.0E-20
sp|O00264|PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens GN=PGRMC1 PE=1 SV=3 274 384 3.0E-20
sp|Q5ZKN2|PGRC1_CHICK Membrane-associated progesterone receptor component 1 OS=Gallus gallus GN=PGRMC1 PE=2 SV=3 274 384 1.0E-18
sp|Q5XIU9|PGRC2_RAT Membrane-associated progesterone receptor component 2 OS=Rattus norvegicus GN=Pgrmc2 PE=1 SV=1 232 383 2.0E-18
sp|Q80UU9|PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus GN=Pgrmc2 PE=1 SV=2 232 383 2.0E-18
sp|O15173|PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens GN=PGRMC2 PE=1 SV=1 269 383 2.0E-17
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 281 382 2.0E-16
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 273 385 4.0E-16
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 282 381 5.0E-14
sp|Q2HIW2|MAPR4_ARATH Membrane-associated progesterone-binding protein 4 OS=Arabidopsis thaliana GN=MAPR4 PE=2 SV=1 279 382 2.0E-13
sp|Q29HF1|NEUFC_DROPS Neuferricin homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11364 PE=3 SV=1 237 382 2.0E-12
sp|Q9W376|NEUFC_DROME Neuferricin homolog OS=Drosophila melanogaster GN=CG12056 PE=2 SV=1 224 382 1.0E-11
sp|Q5SSH8|NEUFC_MOUSE Neuferricin OS=Mus musculus GN=Cyb5d2 PE=1 SV=1 267 382 4.0E-11
sp|Q6AY62|NEUFC_RAT Neuferricin OS=Rattus norvegicus GN=Cyb5d2 PE=2 SV=1 271 382 5.0E-11
sp|Q9CQ45|NENF_MOUSE Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1 256 344 9.0E-11
sp|Q6IUR5|NENF_RAT Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1 247 344 2.0E-10
sp|Q8WUJ1|NEUFC_HUMAN Neuferricin OS=Homo sapiens GN=CYB5D2 PE=2 SV=1 274 382 3.0E-10
sp|Q9XXA7|NEUFC_CAEEL Neuferricin homolog OS=Caenorhabditis elegans GN=tag-131 PE=3 SV=1 280 383 3.0E-10
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 280 383 4.0E-10
sp|Q9UMX5|NENF_HUMAN Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1 262 379 6.0E-10
sp|Q28FI8|NEUFC_XENTR Neuferricin OS=Xenopus tropicalis GN=cyb5d2 PE=2 SV=1 279 382 2.0E-09
sp|Q1JQA5|NENF_BOVIN Neudesin OS=Bos taurus GN=NENF PE=2 SV=1 263 379 2.0E-09
sp|A2CES0|NEUFC_DANRE Neuferricin OS=Danio rerio GN=cyb5d2 PE=3 SV=1 280 382 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024870
MMYVKLLIGIVVGVASMANAAAEAYTRNIDTCGYIHQVLKVSQSLIPGKKVNVGFIDACLCQNDVYNFVSSDPVA
MKGVRRAGKSSVISTIKTMIKNNGRVCHYPDHAIATCTKGNPCKFDCKDGYQPFPRNNPTQCVCNKPYMECNGKC
GQYQGCPSGRPHYRRTRDYLCPAEMKACGTWNRGARSWECIDTDNELESCGGCVIALPGEEEGGEDCSKREGNVG
CVEGTPVNTALFVYILYSVQRILFPKSKSGPIPNEFKAGYSWMPKSHPPSVLFKIYTPKTLEPFNGQDGRRILLA
IDGTVYDVTSGRNFYGPNGMYGNFAGRDASRGMAKQSFDPEMLTPVDQPLDSLQDLKPDEIDNMKGWIEHFSNKY
IICGKLVENDAV*
Coding >AgabiH97|024870
ATGATGTATGTCAAGTTGCTTATTGGAATCGTGGTCGGTGTGGCGAGTATGGCCAATGCGGCGGCGGAGGCGTAC
ACCAGAAATATTGATACTTGTGGATATATTCATCAAGTATTGAAAGTTTCTCAATCGTTGATTCCGGGTAAAAAA
GTCAATGTCGGATTTATCGATGCGTGTCTCTGTCAGAATGATGTGTATAATTTCGTTTCGAGCGATCCCGTTGCT
ATGAAAGGTGTCCGACGCGCAGGAAAGTCATCCGTCATTTCTACTATCAAGACCATGATTAAAAATAATGGCCGA
GTATGTCATTACCCCGACCACGCCATCGCCACCTGTACAAAAGGCAATCCTTGTAAATTCGACTGCAAAGACGGA
TACCAACCTTTTCCGAGGAACAACCCGACCCAATGTGTTTGCAACAAACCGTATATGGAATGTAACGGAAAATGC
GGACAATATCAAGGATGTCCAAGTGGGAGACCTCATTATCGCCGGACTCGTGACTATCTATGTCCTGCTGAGATG
AAGGCTTGTGGAACTTGGAATCGAGGTGCAAGATCATGGGAATGCATTGATACCGATAATGAATTAGAGAGTTGT
GGTGGTTGCGTGATAGCGCTCCCTGGAGAAGAGGAAGGAGGAGAGGATTGTTCTAAGCGCGAGGGAAATGTGGGA
TGTGTCGAGGGGACACCCGTAAACACAGCGCTGTTTGTATACATCCTCTACTCCGTCCAACGCATCCTCTTTCCC
AAATCCAAGTCTGGGCCCATTCCCAACGAATTCAAAGCCGGCTACTCATGGATGCCTAAATCACACCCTCCCTCC
GTCCTCTTCAAGATTTACACTCCAAAGACACTTGAACCGTTCAATGGCCAGGATGGCAGGAGAATTCTGTTGGCT
ATTGATGGTACGGTGTATGATGTGACGAGTGGGAGAAATTTCTATGGCCCTAACGGTATGTATGGCAATTTCGCG
GGAAGAGACGCATCGAGGGGCATGGCCAAGCAGAGCTTTGATCCCGAAATGTTGACGCCAGTAGACCAACCCCTC
GACTCGCTCCAGGACCTCAAACCAGATGAAATTGACAATATGAAAGGCTGGATTGAGCATTTCTCCAACAAGTAC
ATCATATGCGGCAAACTGGTCGAGAACGATGCTGTCTGA
Transcript >AgabiH97|024870
ATGATGTATGTCAAGTTGCTTATTGGAATCGTGGTCGGTGTGGCGAGTATGGCCAATGCGGCGGCGGAGGCGTAC
ACCAGAAATATTGATACTTGTGGATATATTCATCAAGTATTGAAAGTTTCTCAATCGTTGATTCCGGGTAAAAAA
GTCAATGTCGGATTTATCGATGCGTGTCTCTGTCAGAATGATGTGTATAATTTCGTTTCGAGCGATCCCGTTGCT
ATGAAAGGTGTCCGACGCGCAGGAAAGTCATCCGTCATTTCTACTATCAAGACCATGATTAAAAATAATGGCCGA
GTATGTCATTACCCCGACCACGCCATCGCCACCTGTACAAAAGGCAATCCTTGTAAATTCGACTGCAAAGACGGA
TACCAACCTTTTCCGAGGAACAACCCGACCCAATGTGTTTGCAACAAACCGTATATGGAATGTAACGGAAAATGC
GGACAATATCAAGGATGTCCAAGTGGGAGACCTCATTATCGCCGGACTCGTGACTATCTATGTCCTGCTGAGATG
AAGGCTTGTGGAACTTGGAATCGAGGTGCAAGATCATGGGAATGCATTGATACCGATAATGAATTAGAGAGTTGT
GGTGGTTGCGTGATAGCGCTCCCTGGAGAAGAGGAAGGAGGAGAGGATTGTTCTAAGCGCGAGGGAAATGTGGGA
TGTGTCGAGGGGACACCCGTAAACACAGCGCTGTTTGTATACATCCTCTACTCCGTCCAACGCATCCTCTTTCCC
AAATCCAAGTCTGGGCCCATTCCCAACGAATTCAAAGCCGGCTACTCATGGATGCCTAAATCACACCCTCCCTCC
GTCCTCTTCAAGATTTACACTCCAAAGACACTTGAACCGTTCAATGGCCAGGATGGCAGGAGAATTCTGTTGGCT
ATTGATGGTACGGTGTATGATGTGACGAGTGGGAGAAATTTCTATGGCCCTAACGGTATGTATGGCAATTTCGCG
GGAAGAGACGCATCGAGGGGCATGGCCAAGCAGAGCTTTGATCCCGAAATGTTGACGCCAGTAGACCAACCCCTC
GACTCGCTCCAGGACCTCAAACCAGATGAAATTGACAATATGAAAGGCTGGATTGAGCATTTCTCCAACAAGTAC
ATCATATGCGGCAAACTGGTCGAGAACGATGCTGTCTGA
Gene >AgabiH97|024870
ATGATGTATGTCAAGTTGCTTATTGGAATCGTGGTCGGTGTGGCGAGTATGGCCAATGCGGCGGCGGAGGCGTAC
ACCAGAAATATTGATACTTGTGGATATATTCATCAAGTATTGAAAGTTTCTCAATCGTTGATTCCGGGTAAAAAA
GTCAATGTCGGATTTATCGGTGAGTTTTTCACATATATGCAAGAAATTGGAAAAACTGATATATATGTGTCGATA
CATACACAGATGCGTGTCTCTGTCAGAATGATGTGTATAATTTCGTTTCGAGCGATCCCGTTGCTATGAAAGGTG
TCCGACGCGCAGGAAAGTCATCCGTCATTTCTACTATCAAGACCATGGTGAGTCTTGAGTGGGATCACGAAAGAA
TGACCTACTGAGACCCATAAGATTAAAAATAATGGCCGAGTATGTCATTACCCCGACCACGCCATCGCCACCTGT
ACAAAAGGCAATCCTTGTAAATTCGACTGCAAAGACGGGTCAGTTTAGGGGAATATGTTGAGCAAACCACACCCT
ACTCACAGGTTTAGATACCAACCTTTTCCGAGGAACAACCCGACCCAATGTGTTTGCAACAAACCGTATATGGAA
TGTAACGGAAAATGCGGACAATATCAAGGATGTCCAAGTGGGAGACCTCATTATCGCCGGACTCGTGACTATCTA
TGTCCTGCTGAGATGAAGGCTTGTGGAACTTGGAATCGAGGTGCAAGATCATGGGAATGCATTGATACCGATAAT
GAATTAGAGAGTTGTACGTGTGCCAATGTGTTTGCGAGGTTACTGTTGCTAACTTTGTGCAAGGTGGTGGTTGCG
TGATAGCGCTCCCTGGAGAAGAGGAAGGAGGAGAGGATTGTTCTAAGCGCGAGGGAAATGTGGGATGTGTCGAGG
GTAGATGTGTGACTCTGTACTAGTTGTGACATCGTCTCATTCTTTCTGTTCAACGATGGCGAGCCTAGGGACACC
CGTAAACACAGCGCTGTTTGTATACATCCTCTACTCCGTCCAACGCATCCTCTTTCCCAAATCCAAGTCTGGGCC
CATTCCCAACGAATTCAAAGCCGGCTACTCATGGATGCCTAAATCACACCCTCCCTCCGTCCTCTTCAAGATTTA
CACTCCAAAGACACTTGAACCGTTCAATGGCCAGGATGGCAGGAGAATTCTGTTGGCTATTGATGGTACGGTGTA
TGATGTGACGAGTGGGAGAAATTTCTATGGCCCTAGTGAGTCGTGTTTCTCTTTCGGCAGTCATAGCTTTAATTG
ATGTGTAGACGGTATGTATGGCAATTTCGCGGGAAGAGACGCATCGAGGGGCATGGCCAAGCAGAGCTTTGATCC
CGGTGAGCACTTTGTCGTTACCCTATATAACGCCCAGCTCAACCTCGACAGAAATGTTGACGCCAGTAGACCAAC
CCCTCGACTCGCTCCAGGACCTCAAACCAGATGAAATGTAACGCTCTCTTCCCCCCACTTTACACAAACCGAGAA
CTGATTGACTGTTCGACTCCAGTGACAATATGAAAGGTGATCATTATACAGGAAGTAATACACTAAGTTGCTCAT
CATTTACAAAACAGGCTGGATTGAGCATTTCTCCAACAAGTACATCATATGCGGCAAACTGGTCGAGAACGATGC
TGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail