Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024790
Gene name
Locationscaffold_11:820991..822611
Strand+
Gene length (bp)1620
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16491 Peptidase_M48_N CAAX prenyl protease N-terminal, five membrane helices 1.7E-62 47 230
PF01435 Peptidase_M48 Peptidase family M48 6.8E-40 233 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 38 458 3.0E-101
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 23 459 4.0E-97
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 29 456 1.0E-89
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 29 460 2.0E-89
sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2 29 451 1.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 38 458 3.0E-101
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 23 459 4.0E-97
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 29 456 1.0E-89
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 29 460 2.0E-89
sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2 29 451 1.0E-88
sp|Q10071|STE24_SCHPO Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.05 PE=3 SV=1 25 451 4.0E-85
sp|Q54FH7|FACE1_DICDI CAAX prenyl protease 1 homolog OS=Dictyostelium discoideum GN=zmpste24 PE=3 SV=1 42 451 3.0E-70
sp|Q9XVE5|FACE1_CAEEL CAAX prenyl protease 1 homolog OS=Caenorhabditis elegans GN=fce-1 PE=1 SV=1 34 458 6.0E-60
sp|P40769|YHFN_BACSU Uncharacterized metalloprotease YhfN OS=Bacillus subtilis (strain 168) GN=yhfN PE=3 SV=2 124 451 3.0E-25
sp|Q3J0F7|HTPX_RHOS4 Protease HtpX homolog OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=htpX PE=3 SV=1 230 455 2.0E-07
sp|A3PLU3|HTPX_RHOS1 Protease HtpX homolog OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=htpX PE=3 SV=1 230 455 2.0E-07
sp|A4WRW9|HTPX_RHOS5 Protease HtpX homolog OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=htpX PE=3 SV=1 230 396 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 172 194 22
3 201 223 22
4 322 344 22
5 349 368 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024790
MDILHNQLQAVQRSLSFVSTDPIDWKFYVQVFAWSVTLFESYLITRQYPLYSKTEPPKALQGHFEKGEFEKSQAY
GKDKARFAFVSGLYKQTLDSLMLQFGFYAWSWQAAGSLLAKFGYGTEHQIIQSIGFVFILFFVSSLPTLPLQVYG
TFVLEEKHGFNKTTPTLFVTDLLKGWAIAFVLGAPFLAVFLYIFEWAGDRFVPWLMAFMITFQLSMVILYPTVIQ
PLFNKLSPLSEGDLRNRIEALAVKLKFPLKHLYEIDGSKRSSHSNAYFFGLPWSKHIVIFDTLIQQSKPEEVEAV
LAHELGHWYYLHPTKLMAVSQLHIFTILALFPAFLHAPPLLSAFDFSKGVAAAPPTIVAFLLFQMILTPLEAVIS
IGMNAVSRQFEWEADKFAVELEEKLNEKDMGDMGDRLGKALITLHVKNLSTVWVDWLYSAYHHSHPTLTERLRAL
EGFAEEKRKKTT*
Coding >AgabiH97|024790
ATGGACATCCTCCACAACCAACTTCAAGCCGTTCAACGCAGCCTCTCGTTTGTTTCTACCGACCCCATAGATTGG
AAATTCTATGTTCAAGTTTTTGCCTGGTCTGTAACGCTTTTTGAGTCATACTTGATAACGAGGCAATATCCACTA
TATTCTAAAACCGAGCCACCGAAAGCTCTACAAGGCCATTTTGAAAAGGGAGAATTTGAAAAATCCCAAGCGTAT
GGAAAAGATAAGGCTAGGTTTGCCTTTGTGTCTGGGTTGTATAAACAGACGCTGGATTCTCTCATGCTACAATTT
GGATTCTACGCGTGGTCGTGGCAGGCTGCTGGGAGCTTATTGGCTAAGTTTGGATATGGTACTGAACACCAGATA
ATACAGTCGATTGGGTTTGTATTTATCTTGTTCTTTGTATCCTCCCTTCCGACGCTACCATTGCAAGTCTATGGA
ACGTTTGTTTTGGAAGAAAAACACGGTTTCAACAAGACGACGCCTACATTATTTGTTACGGATTTATTGAAAGGC
TGGGCCATTGCTTTCGTTCTTGGTGCACCCTTCTTGGCGGTCTTCTTATACATCTTTGAGTGGGCTGGAGACAGA
TTCGTACCTTGGCTAATGGCTTTCATGATTACGTTCCAGTTGTCGATGGTCATACTCTATCCGACGGTTATCCAA
CCGTTGTTTAACAAATTGTCGCCTCTCTCAGAAGGTGACCTGAGGAACAGGATTGAAGCTCTAGCTGTCAAACTG
AAGTTCCCGTTGAAGCATTTGTATGAGATTGATGGAAGCAAGAGGAGTTCACATTCGAATGCATACTTCTTTGGT
TTGCCCTGGAGCAAGCACATTGTGATTTTCGATACTCTTATCCAGCAATCCAAGCCTGAGGAGGTGGAAGCTGTG
CTTGCACATGAGCTCGGACACTGGTATTACCTCCACCCTACCAAGCTTATGGCCGTCTCCCAGCTACACATTTTC
ACTATCCTCGCGCTTTTCCCTGCTTTCTTGCATGCGCCTCCCTTGCTGAGTGCTTTTGACTTTTCCAAAGGAGTT
GCGGCGGCACCGCCAACGATTGTGGCATTCCTTCTTTTCCAAATGATTCTTACGCCTCTAGAGGCCGTTATTAGT
ATTGGCATGAATGCGGTCAGTCGCCAGTTTGAGTGGGAGGCGGACAAATTTGCGGTGGAATTGGAGGAAAAGCTG
AATGAGAAGGATATGGGGGATATGGGAGACCGATTGGGAAAAGCGTTGATTACGCTGCACGTGAAAAACCTGTCG
ACGGTGTGGGTTGACTGGCTGTACTCTGCGTACCACCACTCGCACCCCACGTTGACGGAGAGACTGAGGGCGCTG
GAAGGATTTGCAGAGGAGAAGAGAAAAAAGACTACTTAG
Transcript >AgabiH97|024790
ATGGACATCCTCCACAACCAACTTCAAGCCGTTCAACGCAGCCTCTCGTTTGTTTCTACCGACCCCATAGATTGG
AAATTCTATGTTCAAGTTTTTGCCTGGTCTGTAACGCTTTTTGAGTCATACTTGATAACGAGGCAATATCCACTA
TATTCTAAAACCGAGCCACCGAAAGCTCTACAAGGCCATTTTGAAAAGGGAGAATTTGAAAAATCCCAAGCGTAT
GGAAAAGATAAGGCTAGGTTTGCCTTTGTGTCTGGGTTGTATAAACAGACGCTGGATTCTCTCATGCTACAATTT
GGATTCTACGCGTGGTCGTGGCAGGCTGCTGGGAGCTTATTGGCTAAGTTTGGATATGGTACTGAACACCAGATA
ATACAGTCGATTGGGTTTGTATTTATCTTGTTCTTTGTATCCTCCCTTCCGACGCTACCATTGCAAGTCTATGGA
ACGTTTGTTTTGGAAGAAAAACACGGTTTCAACAAGACGACGCCTACATTATTTGTTACGGATTTATTGAAAGGC
TGGGCCATTGCTTTCGTTCTTGGTGCACCCTTCTTGGCGGTCTTCTTATACATCTTTGAGTGGGCTGGAGACAGA
TTCGTACCTTGGCTAATGGCTTTCATGATTACGTTCCAGTTGTCGATGGTCATACTCTATCCGACGGTTATCCAA
CCGTTGTTTAACAAATTGTCGCCTCTCTCAGAAGGTGACCTGAGGAACAGGATTGAAGCTCTAGCTGTCAAACTG
AAGTTCCCGTTGAAGCATTTGTATGAGATTGATGGAAGCAAGAGGAGTTCACATTCGAATGCATACTTCTTTGGT
TTGCCCTGGAGCAAGCACATTGTGATTTTCGATACTCTTATCCAGCAATCCAAGCCTGAGGAGGTGGAAGCTGTG
CTTGCACATGAGCTCGGACACTGGTATTACCTCCACCCTACCAAGCTTATGGCCGTCTCCCAGCTACACATTTTC
ACTATCCTCGCGCTTTTCCCTGCTTTCTTGCATGCGCCTCCCTTGCTGAGTGCTTTTGACTTTTCCAAAGGAGTT
GCGGCGGCACCGCCAACGATTGTGGCATTCCTTCTTTTCCAAATGATTCTTACGCCTCTAGAGGCCGTTATTAGT
ATTGGCATGAATGCGGTCAGTCGCCAGTTTGAGTGGGAGGCGGACAAATTTGCGGTGGAATTGGAGGAAAAGCTG
AATGAGAAGGATATGGGGGATATGGGAGACCGATTGGGAAAAGCGTTGATTACGCTGCACGTGAAAAACCTGTCG
ACGGTGTGGGTTGACTGGCTGTACTCTGCGTACCACCACTCGCACCCCACGTTGACGGAGAGACTGAGGGCGCTG
GAAGGATTTGCAGAGGAGAAGAGAAAAAAGACTACTTAG
Gene >AgabiH97|024790
ATGGACATCCTCCACAACCAACTTCAAGCCGTTCAACGCAGCCTCTCGTTTGTTTCTACCGACCCCATAGATTGG
AAATTCTATGTTCAAGTTTTTGCCTGGTCTGTAACGCTTTTTGAGTCATACTTGATGTGCGTTGTATTTTTCCTT
TTTCGTGTTTTCCACCCCTTCATAATTTTCCTCATAGAACGAGGCAATATCCACTATATTCTAAAACCGAGCCAC
CGAAAGCTCTACAAGGCCATTTTGAAAAGGGAGAATTTGAAAAATCCCAAGCGTATGGAAAAGATAAGGCTAGGT
TTGCCTTTGTGTCTGGGTTGTATAAACAGACGCTGGATTCTCTCATGCTACAATTTGGATTCTACGCGTGGTCGT
GGCAGGCTGCTGGGAGCTTATTGGCTAAGTTTGGATATGGTACTGAACACCAGGTACTTTCATTTTTTCCTTCTC
TTTCTACACCGTCCCCTTAAACTGACTGGTTTTGGTCGCATAGATAATACAGTCGATTGGGTTTGTATTTATCTT
GTTCTTTGTATCCTCCCTTCCGACGCTACCATTGCAAGTCTATGGAACGTTTGTTTTGGAAGAAAAACACGGTTT
CAACAAGACGACGCCTACATTATTTGTTACGGATTTATTGAAAGGCTGGGCCATTGCTTTCGTTCTTGGTGCACC
CTTCTTGGCGGTCTTCTTATACATCTTTGAGTGGGCTGGAGACAGATTCGTACCTTGGCTAATGGCTTTCATGTG
AGTTCGAAATTCTATTGTTCGTTGATCGTTGAATGATAATAATATGCATCCATAAAGGATTACGTTCCAGTTGTC
GATGGTCATACTCTATCCGACGGTTATCCAACCGTTGTTTAACAAATTGTCGCCTCTCTCAGAAGGTGACCTGAG
GAACAGGATTGAAGCTCTAGCTGTCAAACTGAAGTTCCCGTTGAAGCATTTGTATGAGATTGATGGAAGCAAGAG
GAGTTCACATTCGAATGCATACTTCTTTGGTTTGCCCTGGGTAAGTTTTATGACATTTCATTGATATTAAATTCT
GACGGTGCTTGTTAGAGCAAGCACATTGTGATTTTCGATACTCTTATCCAGCAATCCAAGCCTGAGGAGGTGGAA
GCTGTGCTTGCACATGAGCTCGGACACTGGTATTACCTCCACCCTACCAAGCTTATGGCCGTCTCCCAGCTACAC
ATTTTCACTATCCTCGCGCTTTTCCCTGCTTTCTTGCATGCGCCTCCCTTGCTGAGTGCTTTTGACTTTTCCAAA
GGAGTTGCGGCGGCACCGCCAACGATTGTGGCATTCCTTCTTTTCCAAATGATTCTTACGCCTCTAGAGGCCGTT
ATTAGTATTGGCATGAATGCGGTCAGTCGCCAGTTTGAGTGGGAGGCGGACAAATTTGCGGTGGAATTGGAGGAA
AAGCTGAATGAGAAGGATATGGGGGATATGGGAGACCGATTGGGAAAAGCGTTGATTACGCTGCACGTGAAAAAC
CTGTCGACGGTGTGGGTTGACTGGCTGTACTCTGCGTACCACCACTCGCACCCCACGTTGACGGAGAGACTGAGG
GCGCTGGAAGGATTTGCAGAGGAGAAGAGAAAAAAGACTACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail