Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024710
Gene name
Locationscaffold_11:800214..801337
Strand+
Gene length (bp)1123
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01636 APH Phosphotransferase enzyme family 6.3E-16 87 274
PF01633 Choline_kinase Choline/ethanolamine kinase 8.9E-07 214 266

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024710
MKYFQTAGWCLLFVGPALAYRHFLTCRIPNRGFGTSIVNYCRRLIITHFSSQFFSWSRRIYGFTGSPRVYRCANT
AIKFGSKARPYEAETTQYIGRHTSIPVPKIIDVWTEKDGSPVTVLEWVDGERLEDAWPTLSSEEKKSIGQQLREH
LDALRALHQPFDSGGWIGSYNKKPISDALLYNDACGPFASDADFNRFLLSRFEFMKKTRAGRIEYDDLEKEVLNT
PRRRVVFTHSDIMPRNILIDSRRKIVALLDWEMSGWMPEQWEYLKAMWMGQYDPVTQQDVQIARGTILSVNFSCP
QTTYI*
Coding >AgabiH97|024710
ATGAAGTACTTCCAAACTGCGGGCTGGTGCCTGCTGTTTGTCGGTCCTGCCCTGGCATACAGGCATTTTCTAACA
TGCAGGATACCGAACCGTGGCTTTGGCACATCAATTGTCAATTATTGCCGTCGTCTTATCATCACGCACTTCAGT
TCTCAATTTTTTTCATGGAGCCGTCGCATCTATGGATTCACTGGAAGTCCCCGTGTATATCGCTGTGCTAACACG
GCTATCAAGTTTGGCTCCAAAGCTCGTCCTTATGAGGCTGAGACTACGCAATACATCGGGCGGCACACTTCTATA
CCTGTTCCAAAAATAATCGATGTTTGGACAGAAAAGGATGGGTCTCCAGTGACTGTATTGGAATGGGTAGATGGA
GAAAGGCTCGAGGATGCCTGGCCAACGTTATCGTCCGAAGAAAAGAAATCAATAGGCCAGCAGCTCAGAGAGCAT
TTGGACGCGCTGAGAGCATTACATCAACCTTTTGACAGTGGAGGATGGATTGGATCCTATAACAAGAAGCCCATA
TCGGATGCGCTGCTCTATAACGACGCGTGTGGCCCTTTTGCTTCAGACGCTGACTTCAACCGTTTCTTGCTGTCC
AGATTCGAGTTCATGAAAAAAACCAGGGCTGGACGAATCGAATATGATGACCTCGAAAAAGAAGTACTTAACACC
CCCCGACGTCGCGTTGTGTTCACCCATTCCGATATCATGCCTCGCAATATCCTCATTGATAGTCGCAGAAAGATT
GTTGCGCTTCTAGACTGGGAGATGTCCGGATGGATGCCCGAACAGTGGGAATATCTGAAAGCCATGTGGATGGGA
CAGTATGACCCAGTTACACAACAAGATGTGCAAATTGCACGGGGCACCATTTTAAGCGTAAATTTCTCTTGCCCT
CAGACGACATATATCTAG
Transcript >AgabiH97|024710
ATGAAGTACTTCCAAACTGCGGGCTGGTGCCTGCTGTTTGTCGGTCCTGCCCTGGCATACAGGCATTTTCTAACA
TGCAGGATACCGAACCGTGGCTTTGGCACATCAATTGTCAATTATTGCCGTCGTCTTATCATCACGCACTTCAGT
TCTCAATTTTTTTCATGGAGCCGTCGCATCTATGGATTCACTGGAAGTCCCCGTGTATATCGCTGTGCTAACACG
GCTATCAAGTTTGGCTCCAAAGCTCGTCCTTATGAGGCTGAGACTACGCAATACATCGGGCGGCACACTTCTATA
CCTGTTCCAAAAATAATCGATGTTTGGACAGAAAAGGATGGGTCTCCAGTGACTGTATTGGAATGGGTAGATGGA
GAAAGGCTCGAGGATGCCTGGCCAACGTTATCGTCCGAAGAAAAGAAATCAATAGGCCAGCAGCTCAGAGAGCAT
TTGGACGCGCTGAGAGCATTACATCAACCTTTTGACAGTGGAGGATGGATTGGATCCTATAACAAGAAGCCCATA
TCGGATGCGCTGCTCTATAACGACGCGTGTGGCCCTTTTGCTTCAGACGCTGACTTCAACCGTTTCTTGCTGTCC
AGATTCGAGTTCATGAAAAAAACCAGGGCTGGACGAATCGAATATGATGACCTCGAAAAAGAAGTACTTAACACC
CCCCGACGTCGCGTTGTGTTCACCCATTCCGATATCATGCCTCGCAATATCCTCATTGATAGTCGCAGAAAGATT
GTTGCGCTTCTAGACTGGGAGATGTCCGGATGGATGCCCGAACAGTGGGAATATCTGAAAGCCATGTGGATGGGA
CAGTATGACCCAGTTACACAACAAGATGTGCAAATTGCACGGGGCACCATTTTAAGCGTAAATTTCTCTTGCCCT
CAGACGACATATATCTAG
Gene >AgabiH97|024710
ATGAAGTACTTCCAAACTGCGGGCTGGTGCCTGCTGTTTGTCGGTCCTGCCCTGGCATACAGGCATTTTCTAACA
TGGTGACGTGACTTCCGACATGACCTTGCCTTGCTTCTCACCTGGTTGAGCAGCAGGATACCGAACCGTGGCTTT
GGCACATCAAGTAAAGCAAACCCTTGCCTTTTCGTCTCTGCATCTAATGAACTGGCTTTCAGTTGTCAATTATTG
CCGTCGTCTTATCATCACGCACTTCAGTTCTCAATTTTTTTCATGGAGCCGTCGCATCTATGGATTCACTGGAAG
TCCCCGTGTATATCGCTGTGCTAACACGGCTATCAAGTTTGGCTCCAAAGCTCGTCCTTATGAGGCTGAGACTAC
GCAATACATCGGGCGGCACACTTCTATACCTGTTCCAAAAATAATCGATGTTTGGACAGAAAAGGATGGGTCTCC
AGTGACTGTATTGGAATGGGTAGATGGAGAAAGGCTCGAGGATGCCTGGCCAACGTTATCGTCCGAAGAAAAGAA
ATCAATAGGCCAGCAGCTCAGAGAGCATTTGGACGCGCTGAGAGCATTACATCAACCTTTTGACAGTGGAGGATG
GATTGGATCCTATAACAAGAAGCCCATATCGGATGCGCTGCTCTATAACGACGCGTGTGGCCCTTTTGCTTCAGA
CGCTGACTTCAACCGTTTCTTGCTGTCCAGATTCGAGTTCATGAAAAAAACCAGGGCTGGACGAATCGAATATGA
TGACCTCGAAAAAGAAGTACTTAACACCCCCCGACGTCGCGTTGTGTTCACCCATTCCGATATCATGCCTCGCAA
TATCCTCATTGATAGTCGCAGAAAGATTGTTGCGCTTCTAGACTGGGAGATGTCCGGATGGATGCCCGAACAGTG
GGAATATCTGAAAGCCATGTGGATGGGACAGTATGACCCAGGTTGGCCTGAATTTGCAGCTATGTGGCTTGATCC
ATACGACGATGATTTGAAGTTACACAACAAGATGTGCAAATTGCACGGGGCACCATTTTAAGGTGGGTCGTAGAT
TCATTCGACTCCGGAATGTCATCTGACTAAACTTAGCGTAAATTTCTCTTGCCCTCAGACGACATATATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail