Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024700
Gene name
Locationscaffold_11:798775..799866
Strand-
Gene length (bp)1091
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 2.6E-11 11 223

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7185 0.4823 0.0421 0.0363 0.2213 0.2437 0.0752 0.0635 0.0283 0.1462

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 56.77 31.82 81.73
Initials Initials knots 53.95 30.93 76.96
Pileal_Stipeal_center Stage I stipe center 19.65 9.83 29.48
Pileal_Stipeal_shell Stage I stipe shell 13.66 6.37 20.95
DIF_stipe_center Stage II stipe center 17.66 8.80 26.51
DIF_stipe_shell Stage II stipe shell 20.81 10.63 31.00
DIF_stipe_skin Stage II stipe skin 20.62 10.47 30.77
DIF_cap_skin Stage II cap skin 9.92 4.54 15.31
DIF_cap_tissue Stage II cap tissue 9.41 4.29 14.53
DIF_gill_tissue Stage II gill tissue 11.44 5.32 17.56
YFB_stipe_center Young fruiting body stipe center 19.91 10.10 29.71
YFB_stipe_shell Young fruiting body stipe shell 21.30 10.91 31.70
YFB_stipe_skin Young fruiting body stipe skin 20.92 10.64 31.19
YFB_cap_skin Young fruiting body cap skin 10.33 4.77 15.90
YFB_cap_tissue Young fruiting body cap tissue 9.72 4.46 14.97
YFB_gill_tissue Young fruiting body gill tissue 15.20 7.31 23.09
YFB_veil Young fruiting body veil 13.35 6.14 20.56

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.001140 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.929767 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.122622 no
DIF_gill_tissue YFB_stipe_shell 0.076984 no
DIF_gill_tissue YFB_stipe_skin 0.084700 no
DIF_gill_tissue YFB_cap_skin 0.879163 no
DIF_gill_tissue YFB_cap_tissue 0.787788 no
DIF_gill_tissue YFB_gill_tissue 0.544174 no
DIF_gill_tissue YFB_veil 0.800276 no
YFB_stipe_center YFB_stipe_shell 0.911733 no
YFB_stipe_center YFB_stipe_skin 0.936612 no
YFB_stipe_center YFB_cap_skin 0.059712 no
YFB_stipe_center YFB_cap_tissue 0.035765 yes
YFB_stipe_center YFB_gill_tissue 0.538175 no
YFB_stipe_center YFB_veil 0.327027 no
YFB_stipe_shell YFB_stipe_skin 0.978459 no
YFB_stipe_shell YFB_cap_skin 0.029164 yes
YFB_stipe_shell YFB_cap_tissue 0.016669 yes
YFB_stipe_shell YFB_gill_tissue 0.407986 no
YFB_stipe_shell YFB_veil 0.223259 no
YFB_stipe_skin YFB_cap_skin 0.035309 yes
YFB_stipe_skin YFB_cap_tissue 0.019169 yes
YFB_stipe_skin YFB_gill_tissue 0.440852 no
YFB_stipe_skin YFB_veil 0.251432 no
YFB_cap_skin YFB_cap_tissue 0.932911 no
YFB_cap_skin YFB_gill_tissue 0.367174 no
YFB_cap_skin YFB_veil 0.621927 no
YFB_cap_tissue YFB_gill_tissue 0.266337 no
YFB_cap_tissue YFB_veil 0.506269 no
YFB_gill_tissue YFB_veil 0.832782 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.001625 yes
Initials YFB_stipe_skin 0.001140 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.001140 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.001140 yes
Initials DIF_stipe_skin 0.002084 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.148790 no
Pileal_Stipeal_center YFB_stipe_center 0.985280 no
Pileal_Stipeal_center YFB_stipe_shell 0.898711 no
Pileal_Stipeal_center YFB_stipe_skin 0.924093 no
Pileal_Stipeal_center YFB_cap_skin 0.066767 no
Pileal_Stipeal_center YFB_cap_tissue 0.043555 yes
Pileal_Stipeal_center YFB_gill_tissue 0.580635 no
Pileal_Stipeal_center YFB_veil 0.354742 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.400613 no
Pileal_Stipeal_center DIF_stipe_center 0.860321 no
Pileal_Stipeal_center DIF_stipe_shell 0.932146 no
Pileal_Stipeal_center DIF_stipe_skin 0.942464 no
Pileal_Stipeal_center DIF_cap_skin 0.050706 no
Pileal_Stipeal_center DIF_cap_tissue 0.038720 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.755965 no
Pileal_Stipeal_shell YFB_stipe_center 0.357627 no
Pileal_Stipeal_shell YFB_stipe_shell 0.253684 no
Pileal_Stipeal_shell YFB_stipe_skin 0.282109 no
Pileal_Stipeal_shell YFB_cap_skin 0.577809 no
Pileal_Stipeal_shell YFB_cap_tissue 0.471571 no
Pileal_Stipeal_shell YFB_gill_tissue 0.867346 no
Pileal_Stipeal_shell YFB_veil 0.976207 no
Pileal_Stipeal_shell DIF_stipe_center 0.596348 no
Pileal_Stipeal_shell DIF_stipe_shell 0.291145 no
Pileal_Stipeal_shell DIF_stipe_skin 0.304591 no
Pileal_Stipeal_shell DIF_cap_skin 0.508210 no
Pileal_Stipeal_shell DIF_cap_tissue 0.406133 no
DIF_stipe_center DIF_gill_tissue 0.277102 no
DIF_stipe_center YFB_stipe_center 0.833930 no
DIF_stipe_center YFB_stipe_shell 0.711411 no
DIF_stipe_center YFB_stipe_skin 0.743527 no
DIF_stipe_center YFB_cap_skin 0.157833 no
DIF_stipe_center YFB_cap_tissue 0.107603 no
DIF_stipe_center YFB_gill_tissue 0.788198 no
DIF_stipe_center YFB_veil 0.552015 no
DIF_stipe_center DIF_stipe_shell 0.757470 no
DIF_stipe_center DIF_stipe_skin 0.768802 no
DIF_stipe_center DIF_cap_skin 0.121568 no
DIF_stipe_center DIF_cap_tissue 0.085898 no
DIF_stipe_shell DIF_gill_tissue 0.099273 no
DIF_stipe_shell YFB_stipe_center 0.944241 no
DIF_stipe_shell YFB_stipe_shell 0.970902 no
DIF_stipe_shell YFB_stipe_skin 0.993868 no
DIF_stipe_shell YFB_cap_skin 0.038047 yes
DIF_stipe_shell YFB_cap_tissue 0.020790 yes
DIF_stipe_shell YFB_gill_tissue 0.457623 no
DIF_stipe_shell YFB_veil 0.261546 no
DIF_stipe_shell DIF_stipe_skin 0.987774 no
DIF_stipe_shell DIF_cap_skin 0.028918 yes
DIF_stipe_shell DIF_cap_tissue 0.021322 yes
DIF_stipe_skin DIF_gill_tissue 0.102350 no
DIF_stipe_skin YFB_stipe_center 0.956864 no
DIF_stipe_skin YFB_stipe_shell 0.959217 no
DIF_stipe_skin YFB_stipe_skin 0.982379 no
DIF_stipe_skin YFB_cap_skin 0.043555 yes
DIF_stipe_skin YFB_cap_tissue 0.025458 yes
DIF_stipe_skin YFB_gill_tissue 0.472029 no
DIF_stipe_skin YFB_veil 0.271359 no
DIF_stipe_skin DIF_cap_skin 0.033906 yes
DIF_stipe_skin DIF_cap_tissue 0.025205 yes
DIF_cap_skin DIF_gill_tissue 0.817551 no
DIF_cap_skin YFB_stipe_center 0.042909 yes
DIF_cap_skin YFB_stipe_shell 0.024698 yes
DIF_cap_skin YFB_stipe_skin 0.027943 yes
DIF_cap_skin YFB_cap_skin 0.956547 no
DIF_cap_skin YFB_cap_tissue 0.977974 no
DIF_cap_skin YFB_gill_tissue 0.299255 no
DIF_cap_skin YFB_veil 0.538776 no
DIF_cap_skin DIF_cap_tissue 0.942907 no
DIF_cap_tissue DIF_gill_tissue 0.732771 no
DIF_cap_tissue YFB_stipe_center 0.027451 yes
DIF_cap_tissue YFB_stipe_shell 0.017507 yes
DIF_cap_tissue YFB_stipe_skin 0.018344 yes
DIF_cap_tissue YFB_cap_skin 0.891462 no
DIF_cap_tissue YFB_cap_tissue 0.965732 no
DIF_cap_tissue YFB_gill_tissue 0.227822 no
DIF_cap_tissue YFB_veil 0.454283 no

Orthologs

Orthofinder run ID1
Orthogroup5616
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024700
Agaricus bisporus var bisporus H97 AgabiH97|024700 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|259_8

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024700
MAIDKSIKQTYDELGYVVVPGLIPQEHWNDLDAACERVVQKTRTGTWSHRRTVGKQFPPFDNDNPDSWGVQHVMH
PQLNEPAFGKWYTSEGLLDIVKELLGCSDEQLQLELFNMLINPLSHDFALRWHRDDVNEKASEEEERNALNTWHY
GVQWNAALRPDSCLYVVPRSHSQVRTPEQRKLSETSDAPENPLDMPGAIRVTLQPGETIFYNSNILHCATYSSTS
PRVTLHGCIGDIRGGSTRARNVLQHGLEWMKGDEFRASLPQGLRARKMLDNLLDMQKNSGPVGYSLQN*
Coding >AgabiH97|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTGGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTCCCGCCATTCGATAATGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAACTAAATGAACCCGCTTTTGGCAAATGGTACACTTCGGAGGGTTTGCTTGACATCGTCAAAGAACTATTG
GGCTGCAGTGATGAGCAACTGCAGTTAGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTC
CGCTGGCATCGCGACGATGTTAATGAGAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTAT
GGAGTGCAGTGGAATGCCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCGCACAGCCAAGTGAGG
ACACCGGAACAACGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCTATCCGA
GTCACTTTACAACCCGGTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCT
CCTCGAGTCACATTACACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCAC
GGACTGGAGTGGATGAAGGGCGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGAT
AACCTTTTGGACATGCAGAAGAACAGCGGCCCAGTCGGGTACTCTCTTCAAAATTGA
Transcript >AgabiH97|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTGGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTCCCGCCATTCGATAATGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAACTAAATGAACCCGCTTTTGGCAAATGGTACACTTCGGAGGGTTTGCTTGACATCGTCAAAGAACTATTG
GGCTGCAGTGATGAGCAACTGCAGTTAGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTC
CGCTGGCATCGCGACGATGTTAATGAGAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTAT
GGAGTGCAGTGGAATGCCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCGCACAGCCAAGTGAGG
ACACCGGAACAACGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCTATCCGA
GTCACTTTACAACCCGGTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCT
CCTCGAGTCACATTACACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCAC
GGACTGGAGTGGATGAAGGGCGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGAT
AACCTTTTGGACATGCAGAAGAACAGCGGCCCAGTCGGGTACTCTCTTCAAAATTGA
Gene >AgabiH97|024700
ATGGCCATCGACAAGTCTATCAAACAAACGTACGACGAGCTGGGCTATGTCGTTGTCCCAGGACTCATTCCCCAG
GAACACTGGAATGATCTAGATGCTGCTTGCGAGAGGGTCGTTCAGAAGACCCGTACGGGCACCTGGTCCCATCGC
AGAACCGTTGGAAAGCAATTCCCGCCATTCGATAATGACAACCCTGATTCCTGGGGTGTGCAGCATGTCATGCAC
CCGCAACTAAATGAACCCGCTTTTGGCAAATGGTACACTTCGGAGGGTTTGCTTGACATCGTCAAAGAACTATTG
GGCTGCAGTGATGAGCAACTGCAGTTAGGTTTGTCCGTTGATTGCATGGGATACCAGTGGCTAACGTATCAGAAA
AGAACTCTTCAATATGCTCATCAATCCCTTAAGCCACGATTTTGCTCTCCGCTGGCATCGCGACGATGTTAATGA
GAAGGCGTCCGAGGAAGAGGAGCGCAATGCTCTGAACACTTGGCATTATGGAGTATGTTTAACTGCATGCTAGCG
ATCTTCGGGTACTCACGACAGTCAACTCTAGGTGCAGTGGAATGCGTATGGTCAGATCTATTACTATACACTTCT
TCGCCATTGAAGTAACCTTCTAGCGCTCTTCGTCCTGATAGCTGCTTATACGTTGTTCCGCGCTCGCACAGCCAA
GTGAGGACACCGGAACAACGTAAGCTTTCGGAAACTTCAGACGCTCCAGAGAATCCTCTGGACATGCCGGGAGCT
ATCCGAGTCACTTTACAACGTGAGCAGAATCATCATTATTTCCCATCTGACGCCGCCTGACCACACTGTTAGCCG
GTGAAACCATATTCTACAATTCAAACATCCTGCACTGCGCCACATACAGTTCTACTTCTCCTCGAGTCACATTAC
ACGGCTGTATCGGTGACATTAGGGGTGGATCTACAAGGGCGCGTAATGTACTTCAGCACGGACTGGAGTGGATGA
AGGGCGACGAGTTTAGGGCATCGCTTCCACAAGGTCTGAGAGCCAGAAAAATGCTTGATAACCTTTTGGACATGC
AGAAGAACAGCGGCCCAGTCGGGTACTCTCTTCAAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail