Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024470
Gene name
Locationscaffold_11:751858..753698
Strand+
Gene length (bp)1840
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 3.0E-46 49 198
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 3.2E-11 247 307
PF00240 ubiquitin Ubiquitin family 6.3E-07 246 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 47 194 3.0E-21
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 47 194 1.0E-20
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 47 194 1.0E-20
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 47 194 2.0E-20
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 47 194 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 47 194 3.0E-21
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 47 194 1.0E-20
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 47 194 1.0E-20
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 47 194 2.0E-20
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 47 194 2.0E-20
sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 47 194 2.0E-20
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 47 194 7.0E-20
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 47 194 2.0E-17
sp|Q96PU4|UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens GN=UHRF2 PE=1 SV=1 47 194 1.0E-16
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 58 194 3.0E-16
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 58 194 3.0E-16
sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 58 194 7.0E-16
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 58 194 2.0E-15
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 58 239 5.0E-15
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 89 201 2.0E-13
sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 58 194 3.0E-13
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 50 197 5.0E-13
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 58 204 5.0E-13
sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 215 315 7.0E-13
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 58 198 3.0E-12
sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 58 194 3.0E-12
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 58 213 1.0E-11
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 58 211 1.0E-11
sp|Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMT3 PE=1 SV=1 235 315 2.0E-11
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 89 293 7.0E-10
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 1 211 3.0E-08
sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 229 314 4.0E-08
sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 234 316 5.0E-08
sp|Q9C5P0|SUVH8_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1 83 200 5.0E-08
sp|Q9FHI0|YDG1_ARATH YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1 58 201 1.0E-07
sp|Q3E8A8|SUMO7_ARATH Putative small ubiquitin-related modifier 7 OS=Arabidopsis thaliana GN=SUMO7 PE=1 SV=2 238 318 8.0E-07
sp|P55852|SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana GN=SUMO1 PE=1 SV=2 230 312 9.0E-07
sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2 240 322 1.0E-06
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 88 200 1.0E-06
sp|Q7ZTK7|SMO2A_XENLA Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-a PE=3 SV=1 240 316 5.0E-06
sp|Q3EC60|SUVHA_ARATH Putative inactive histone-lysine N-methyltransferase family member SUVH10 OS=Arabidopsis thaliana GN=SUVH10 PE=3 SV=1 89 219 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024470
MAMERLRRQIMQNDQSGTYRFNDDTGGATQIASPKGGDFLSSEASAADHYGHPDKCPVGRIFESRKACYDAKVHR
APMKGILGTVSEGAYSIVMNDGYEDDVDEGDVVYYTGAGGQENFGSSVQIKDQSFDHLDNRTLQRNIVTKHPVRV
IRGSKNSKYGLFRGYRYDGLYDVVHADYAKGKRGYQICRFKLQRRPGQLPLKDLPHAVITWNKRNVHSINWALHF
PLTMSQEPEDVKPKLNLTVLYEGESITVKVRPTMQFSKIFQAAEKRFQKEPGTFRFTYDGQRVNANDTPGDLNME
EGDQIDAHLGQVGGCFEHSFSGLAV*
Coding >AgabiH97|024470
ATGGCCATGGAAAGACTCCGCCGGCAAATTATGCAGAATGACCAAAGCGGTACTTATCGCTTCAACGATGATACC
GGCGGCGCTACCCAAATCGCGTCCCCGAAGGGTGGGGACTTCCTCTCGAGTGAGGCATCAGCAGCGGATCATTAT
GGGCATCCGGATAAATGTCCTGTCGGTCGCATCTTTGAAAGTCGGAAGGCTTGTTATGATGCGAAAGTTCATCGA
GCGCCCATGAAAGGTATTCTCGGCACTGTCAGTGAGGGTGCTTATTCGATAGTGATGAATGATGGGTATGAGGAT
GATGTTGACGAGGGCGACGTGGTCTATTACACTGGAGCCGGAGGGCAGGAGAACTTTGGCAGTTCGGTACAAATC
AAGGATCAAAGCTTTGATCACCTTGATAATCGCACTCTTCAGAGGAATATCGTTACGAAGCATCCTGTGAGAGTC
ATCCGTGGAAGCAAGAATTCTAAATATGGGCTTTTCAGAGGATACCGTTATGATGGTTTATATGATGTAGTCCAC
GCAGACTATGCTAAGGGAAAACGCGGTTATCAAATTTGTAGATTCAAGCTGCAAAGACGTCCTGGACAACTGCCT
TTGAAAGATTTGCCGCACGCGGTTATCACGTGGAATAAGCGTAACGTTCACAGCATAAACTGGGCATTACACTTT
CCTTTGACCATGTCACAAGAGCCCGAGGACGTGAAGCCAAAGCTTAATTTGACTGTCCTTTACGAGGGAGAATCG
ATCACCGTCAAAGTGAGACCTACAATGCAATTTTCCAAGATTTTTCAAGCGGCAGAGAAACGGTTTCAAAAGGAA
CCCGGCACCTTCCGATTCACATACGATGGGCAACGAGTAAATGCAAATGATACACCAGGAGACTTAAACATGGAA
GAGGGTGATCAGATTGATGCTCATTTGGGGCAGGTGGGCGGTTGTTTTGAACATTCCTTTTCGGGTCTTGCTGTT
TGA
Transcript >AgabiH97|024470
ATGGCCATGGAAAGACTCCGCCGGCAAATTATGCAGAATGACCAAAGCGGTACTTATCGCTTCAACGATGATACC
GGCGGCGCTACCCAAATCGCGTCCCCGAAGGGTGGGGACTTCCTCTCGAGTGAGGCATCAGCAGCGGATCATTAT
GGGCATCCGGATAAATGTCCTGTCGGTCGCATCTTTGAAAGTCGGAAGGCTTGTTATGATGCGAAAGTTCATCGA
GCGCCCATGAAAGGTATTCTCGGCACTGTCAGTGAGGGTGCTTATTCGATAGTGATGAATGATGGGTATGAGGAT
GATGTTGACGAGGGCGACGTGGTCTATTACACTGGAGCCGGAGGGCAGGAGAACTTTGGCAGTTCGGTACAAATC
AAGGATCAAAGCTTTGATCACCTTGATAATCGCACTCTTCAGAGGAATATCGTTACGAAGCATCCTGTGAGAGTC
ATCCGTGGAAGCAAGAATTCTAAATATGGGCTTTTCAGAGGATACCGTTATGATGGTTTATATGATGTAGTCCAC
GCAGACTATGCTAAGGGAAAACGCGGTTATCAAATTTGTAGATTCAAGCTGCAAAGACGTCCTGGACAACTGCCT
TTGAAAGATTTGCCGCACGCGGTTATCACGTGGAATAAGCGTAACGTTCACAGCATAAACTGGGCATTACACTTT
CCTTTGACCATGTCACAAGAGCCCGAGGACGTGAAGCCAAAGCTTAATTTGACTGTCCTTTACGAGGGAGAATCG
ATCACCGTCAAAGTGAGACCTACAATGCAATTTTCCAAGATTTTTCAAGCGGCAGAGAAACGGTTTCAAAAGGAA
CCCGGCACCTTCCGATTCACATACGATGGGCAACGAGTAAATGCAAATGATACACCAGGAGACTTAAACATGGAA
GAGGGTGATCAGATTGATGCTCATTTGGGGCAGGTGGGCGGTTGTTTTGAACATTCCTTTTCGGGTCTTGCTGTT
TGA
Gene >AgabiH97|024470
ATGGCCATGGAAAGACTGTTAGTCCCCGTCCTCTCAATTTTAAGCCGCATTGACAATTTCTTTGCAGCCGCCGGC
AAATTATGCAGAATGACCAAAGCGGTACTTATCGCTTCAACGATGATACCGGCGGCGCTACCCAAATCGCGTCCC
CGAAGGGTGGGGACTTCCTCTCGAGTGAGGCATCAGCAGCGGATCATTATGGGCATCCGGATAAATGTCCTGTCG
GTCGCATCTTTGAAAGTCGGTGCGTTGACTCGCCTCAACCAGACTGTGGGCATCATCATCTTATGAGGCCTTTTG
TTGCTCTTTCATGTAGGAAGGCTTGTTATGATGCGAAAGTTCATCGAGCGCCCATGAAAGGTATTCTCGGCACTG
TCAGTGAGGGTGCTTATTCGATAGTGATGAATGATGGGTATGAGGATGATGTTGACGAGGGCGACGTGGTGTGGG
TCGTACGCTCTTCAATCTCAGTAGATCTGTGTCTCACCCTACAAAAACAGCTATTACACTGGAGCCGGAGGGCAG
GAGAACTTTGGCAGTGTACGTCCTTAGCACTATCCTTCTTGGCCTTAAAAGTATCACTGACTCCATCATTTTTTA
CAGTCGGTACAAATCAAGGATCAAAGCTTTGATCACCTTGATAATCGCACTCTTCAGGTAGGTGGTTTCCGTGGA
GCACAAGTTCACCCTAACTTTTGAGCGTAAAGAGGAATATCGTTACGAAGCATCCTGTGAGAGTCATCCGTGGAA
GCAAGAATTCTAAATATGGGCTTTTCAGAGGGTGAGCTTCGTCGACGTTTATGATACCTCTCTCTGACTGTGACG
CATTGCTTCGTTAGATACCGTTATGATGGTTTATATGATGTAGTCCACGTAAGTGCTTTGTCTATTGAAATATGT
CACCCAGCTGATTCGTATATGCACAGGCAGACTATGCTAAGGGAAAACGCGGTTATCAAATTTGTAGATTCAAGC
TGCAAGTGAGATCCCATCCTTTTCTTTTCAATCGAAGAAGGTATTAACTATTAATGCAGAGACGTCCTGGACAAC
TGCCTTTGAAAGATTTGCCGCGTATGTAACACTCTGCTTGATACCATAATGCTTCAGCTTTGTATTTTTATAAAC
CATATTGGGCTATGTTATTGCTTTTTGTCGCGGTGTGACTGAAGACGCGGTTATCACGTGGAATAAGCGTAACGT
TCACAGCATAAACTGGGCATTACACTTTCCTTTGACCATGTCACAAGAGCCCGAGGACGTGAAGCCAAAGCTTAA
TTTGACTGTCCTTTACGAGGGAGAATGTGCGTTATCTGTCGTGCCGGAATCGATGCTCCATCGTGATTTTCTTTC
GCAGCGATCACCGTCAAAGTGAGACCTACAATGCAATTTTCCAAGATTTTTCAAGCGGCAGAGGTGTGTGCGCTT
AACCTCCAACTGCCTTGGAAGCTATTTTGACTTTGTATATAGAAACGGTTTCAAAAGGAACCCGGTGCGTCCTCA
CTTCCACAAAGTTGGATCCATCGACCTAATCAATCATGTCCAATACCTCGTCTTGTGAACGGGCATTACGCTGCA
AATAGGCACCTTCCGATTCACATACGATGGGCAACGAGTAAATGCAAATGATACACCAGGAGACGTTAGTTCCTC
TTTTCTTCGCGCATCAATTTATTTTAAATGCGGTTTATTTCAGTTAAACATGGAAGAGGGTGATCAGATTGATGC
TCATTTGGGGCAGGTACGCCTCTTTCTTGTTTCCCCCTCTCTCACATGTACTCATGCACTCTCATGTTAGGTGGG
CGGTTGTTTTGAACATTCCTTTTCGGGTCTTGCTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail