Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024350
Gene name
Locationscaffold_11:724453..725535
Strand-
Gene length (bp)1082
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 8.6E-51 54 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 6 210 3.0E-29
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 52 212 9.0E-29
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 36 206 2.0E-28
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 52 212 2.0E-28
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 36 206 8.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 6 210 3.0E-29
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 52 212 9.0E-29
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 36 206 2.0E-28
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 52 212 2.0E-28
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 36 206 8.0E-28
sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 52 212 4.0E-27
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 60 212 5.0E-27
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 60 212 6.0E-27
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 52 212 2.0E-26
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 60 212 2.0E-24
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 6 212 1.0E-23
sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 60 212 1.0E-23
sp|Q96PU4|UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens GN=UHRF2 PE=1 SV=1 6 212 2.0E-22
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 56 213 2.0E-21
sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 60 212 2.0E-20
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 60 213 5.0E-20
sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 60 212 2.0E-18
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 7 212 3.0E-17
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 56 213 2.0E-16
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 56 212 3.0E-16
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 9 210 6.0E-15
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 56 213 5.0E-14
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 56 213 1.0E-13
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 52 208 1.0E-13
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 7 219 6.0E-11
sp|Q9C5P0|SUVH8_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH8 OS=Arabidopsis thaliana GN=SUVH8 PE=3 SV=1 7 219 7.0E-11
sp|Q9FHI0|YDG1_ARATH YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1 7 213 4.0E-09
sp|Q3EC60|SUVHA_ARATH Putative inactive histone-lysine N-methyltransferase family member SUVH10 OS=Arabidopsis thaliana GN=SUVH10 PE=3 SV=1 98 212 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024350
MSSGPGQRFSLIRREIKASRGGSDATRRSESAATRQGFLTIGPKKRPTREGYYGPPKCPVGTMFASRKECSEAGV
HFPLVAGISGSTSSTRRDANPGAFSIVLNGGYEDDVDDGNTILYTGAGGQTNTFSKTNSQVENQDIKHHFNHALR
LNLYSGNPVRVVRGFKSESRWAPSEGYRYDGLYKVAGAKIKLGKSGHQVCLFRLERLPDQQPLEELQSHLP*
Coding >AgabiH97|024350
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGGTTCTTGACTATAGGGCCAAAAAAGCGCCCCACCCGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCTTCAAGAAAAGAGTGCTCGGAGGCGGGAGTC
CACTTCCCATTGGTAGCCGGAATATCTGGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCC
ATTGTTCTCAATGGTGGTTATGAAGATGACGTTGATGATGGAAATACCATTCTTTACACTGGAGCCGGGGGCCAA
ACAAATACTTTTAGCAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGT
TTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGCGAGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAA
GGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGC
CTATTTCGGCTGGAGCGTCTTCCCGACCAACAGCCCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA
Transcript >AgabiH97|024350
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGGTTCTTGACTATAGGGCCAAAAAAGCGCCCCACCCGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCTTCAAGAAAAGAGTGCTCGGAGGCGGGAGTC
CACTTCCCATTGGTAGCCGGAATATCTGGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCC
ATTGTTCTCAATGGTGGTTATGAAGATGACGTTGATGATGGAAATACCATTCTTTACACTGGAGCCGGGGGCCAA
ACAAATACTTTTAGCAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGT
TTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGCGAGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAA
GGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGC
CTATTTCGGCTGGAGCGTCTTCCCGACCAACAGCCCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA
Gene >AgabiH97|024350
ATGAGTTCGGGACCAGGGCAAAGGTTTTCACTCATCCGTAGGGAGATAAAGGCATCCAGAGGTGGCAGCGACGCC
ACGAGACGGTCTGAAAGCGCAGCCACTCGTCAAGGGTTCTTGACTATAGGGCCAAAAAAGCGCCCCACCCGAGAG
GGATACTATGGACCTCCAAAGTGCCCAGTTGGGACCATGTTTGCTTCAAGGTTTGCTGAGAGGCTAGCCTGAATG
TAATTAAGCTTATAGTAGACTAGAAAAGAGTGCTCGGAGGCGGGAGTCCACTTCCCATTGGTAGCCGGAATATCT
GGTTCAACAAGTTCTACGAGGCGGGACGCTAACCCGGGAGCCTTCTCCATTGTTCTCAATGGTGGTTATGAAGAT
GACGTTGATGATGGAAATACCATGTGAGTTTGCTTTTATAAACTTGAATGCCAACTGAGTTGAACTGACAATGAT
GGACATGACAGTCTTTACACTGGAGCCGGTATGTATTTAGCTGATGAGCCTGATCCAAGTTCATATCTACATACT
GCATACAGGGGGCCAAACAAATACTTTTAGCAAGGTGTGGGTTCAAACGATGCTGAATCTCAGTATTTCTGACTA
GTCAAAGACAAATTCACAAGTTGAAAACCAGGACATCAAGCATCACTTCAATCATGCTCTTCGTGTATGATACAG
TTTCTTCTTTGTCTCAGCCCTCTCACATGGTCCGATAGTTGAATCTATATTCGGGCAATCCAGTCCGAGTTGTGC
GAGGTTTCAAGAGTGAGTCCAGGTGGGCACCTAGTGAAGGGTAAGTTAGAATGCTCATCCTCATGCAGAAACTGA
TTTACTCCACTAGCTACCGTTACGACGGCCTTTATAAAGTTGCCGGGGTACGTACCGTCCTGTCTGTGTTTCTTG
AAAATGGACTTAATGATTGGGATCAGGCCAAGATAAAATTGGGAAAGAGTGGGCATCAAGTCTGCCTATTTCGGC
TGGAGGTTCGTGCTCTCTATTGTCAAAACCTGGGTGCTTGCTAACCCCGGTGATAGCGTCTTCCCGACCAACAGC
CCCTAGAAGAGTTGCAGAGCCATCTGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail