Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024340
Gene name
Locationscaffold_11:722304..722725
Strand-
Gene length (bp)421
Transcript length (bp)216
Coding sequence length (bp)216
Protein length (aa) 72

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06842 DUF1242 Protein of unknown function (DUF1242) 9.3E-17 10 43

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJC2|KISHA_DANRE Protein kish-A OS=Danio rerio GN=tmem167a PE=3 SV=1 1 71 2.0E-27
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
sp|Q8TBQ9|KISHA_HUMAN Protein kish-A OS=Homo sapiens GN=TMEM167A PE=1 SV=1 1 69 1.0E-26
sp|Q148I3|KISHA_BOVIN Protein kish-A OS=Bos taurus GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BJC2|KISHA_DANRE Protein kish-A OS=Danio rerio GN=tmem167a PE=3 SV=1 1 71 2.0E-27
sp|B5G2S6|KISHA_TAEGU Protein kish-A OS=Taeniopygia guttata GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
sp|Q5RAL1|KISHA_PONAB Protein kish-A OS=Pongo abelii GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
sp|Q8TBQ9|KISHA_HUMAN Protein kish-A OS=Homo sapiens GN=TMEM167A PE=1 SV=1 1 69 1.0E-26
sp|Q148I3|KISHA_BOVIN Protein kish-A OS=Bos taurus GN=TMEM167A PE=3 SV=1 1 69 1.0E-26
sp|Q5ZII6|KISHA_CHICK Protein kish-A OS=Gallus gallus GN=TMEM167A PE=3 SV=1 1 70 2.0E-26
sp|Q9CR64|KISHA_MOUSE Protein kish-A OS=Mus musculus GN=Tmem167a PE=1 SV=1 1 70 2.0E-26
sp|Q28FL7|KISHA_XENTR Protein kish-A OS=Xenopus tropicalis GN=tmem167a PE=3 SV=2 1 70 7.0E-21
sp|Q8TGJ3|KISH_YEAST Protein kish OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSH1 PE=3 SV=1 1 67 1.0E-20
sp|A2VDC5|KISHA_XENLA Protein kish-A OS=Xenopus laevis GN=tmem167a PE=3 SV=1 1 70 2.0E-20
sp|Q9VWH8|KISH_DROME Protein kish OS=Drosophila melanogaster GN=ksh PE=3 SV=2 1 70 3.0E-20
sp|Q54HH9|KISH_DICDI Protein kish OS=Dictyostelium discoideum GN=tmem167 PE=3 SV=1 1 69 5.0E-20
sp|G2TRS3|KISH_SCHPO Protein kish OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksh1 PE=2 SV=1 1 70 4.0E-19
sp|Q28GL2|KISHB_XENTR Protein kish-B OS=Xenopus tropicalis GN=tmem167b PE=3 SV=1 1 70 1.0E-07
sp|Q6DE23|KISHB_XENLA Protein kish-B OS=Xenopus laevis GN=tmem167b PE=3 SV=1 1 70 1.0E-07
sp|Q5RAU6|KISHB_PONAB Protein kish-B OS=Pongo abelii GN=TMEM167B PE=3 SV=1 1 70 3.0E-07
sp|Q9NRX6|KISHB_HUMAN Protein kish-B OS=Homo sapiens GN=TMEM167B PE=3 SV=1 1 70 3.0E-07
sp|Q80X45|KISHB_MOUSE Protein kish-B OS=Mus musculus GN=Tmem167b PE=3 SV=1 1 70 5.0E-07
sp|Q0IIL4|KISHB_BOVIN Protein kish-B OS=Bos taurus GN=TMEM167B PE=3 SV=1 1 70 5.0E-07
sp|Q6AZW1|KISHB_DANRE Protein kish-B OS=Danio rerio GN=tmem167b PE=3 SV=1 1 70 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 70 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024340
MSALFNFQALLLVILLGICTCTYVRAVAPSLVDRNRHGFPGLVFKSARIGERLSPYVALACVAMAITILLE*
Coding >AgabiH97|024340
ATGTCCGCCCTATTCAACTTCCAAGCTCTCCTTCTCGTCATTCTCCTCGGCATCTGCACATGTACATATGTACGC
GCAGTCGCACCCAGTCTCGTCGACCGAAACAGACATGGATTCCCCGGTCTAGTTTTCAAATCAGCTCGAATCGGT
GAACGATTGTCTCCCTACGTCGCACTGGCATGCGTAGCAATGGCAATCACAATCCTGCTCGAATAA
Transcript >AgabiH97|024340
ATGTCCGCCCTATTCAACTTCCAAGCTCTCCTTCTCGTCATTCTCCTCGGCATCTGCACATGTACATATGTACGC
GCAGTCGCACCCAGTCTCGTCGACCGAAACAGACATGGATTCCCCGGTCTAGTTTTCAAATCAGCTCGAATCGGT
GAACGATTGTCTCCCTACGTCGCACTGGCATGCGTAGCAATGGCAATCACAATCCTGCTCGAATAA
Gene >AgabiH97|024340
ATGGTACGCTAAAACCGCTTCAACTTACCACACCAAACATATGTAGCTAACCTTTTCTCAATCCTCTTCCGTAGT
CCGCCCTATTCAACTTCCAAGCTCTCCTTCTCGTCATTCTCCTCGGCATCTGCACATGTACATATGTACGCGCAG
TCGCACCCAGTCTCGTCGACCGAAACAGACATGGGTTCGTACTCCATCTTACTTTCTCTTTCTCTCGTAAATAAC
AACTACTGATTAACATTTGTGTTACTCCATTCAGATTCCCCGGTCTAGTTTTCAAATCAGCTCGAATCGGTCCGT
ATTTCTCCCTGAAAAATCTGTATGACGCGTTGCTCATAAGTTTCTACCTCCAGGTGAACGATTGTCTCCCTACGT
CGCACTGGCATGCGTAGCAATGGCAATCACAATCCTGCTCGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail