Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024140
Gene name
Locationscaffold_11:678733..679126
Strand+
Gene length (bp)393
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 6.1E-17 67 111

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 7 112 3.0E-33
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 49 111 2.0E-19

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1054 0.0378 0.9513 0.0634 0.0488 0.0206 0.2918 0.1847 0.1856 0.0011

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999728

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 16.60 5.85 27.34
Initials Initials knots 18.11 6.58 29.65
Pileal_Stipeal_center Stage I stipe center 30.41 12.54 48.27
Pileal_Stipeal_shell Stage I stipe shell 37.29 16.07 58.50
DIF_stipe_center Stage II stipe center 33.51 14.21 52.82
DIF_stipe_shell Stage II stipe shell 29.94 12.18 47.70
DIF_stipe_skin Stage II stipe skin 35.30 15.08 55.52
DIF_cap_skin Stage II cap skin 38.90 16.86 60.94
DIF_cap_tissue Stage II cap tissue 34.72 14.78 54.66
DIF_gill_tissue Stage II gill tissue 31.82 13.34 50.31
YFB_stipe_center Young fruiting body stipe center 34.08 14.30 53.86
YFB_stipe_shell Young fruiting body stipe shell 26.42 10.57 42.27
YFB_stipe_skin Young fruiting body stipe skin 34.00 14.35 53.65
YFB_cap_skin Young fruiting body cap skin 39.49 17.05 61.94
YFB_cap_tissue Young fruiting body cap tissue 35.41 15.00 55.82
YFB_gill_tissue Young fruiting body gill tissue 30.15 12.17 48.13
YFB_veil Young fruiting body veil 32.84 13.78 51.90

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.131110 no
Casing YFB_stipe_center 0.083328 no
Casing YFB_stipe_shell 0.350076 no
Casing YFB_stipe_skin 0.085726 no
Casing YFB_cap_skin 0.030610 yes
Casing YFB_cap_tissue 0.065276 no
Casing YFB_gill_tissue 0.188780 no
Casing YFB_veil 0.105226 no
Casing Initials 0.916488 no
Casing Pileal_Stipeal_center 0.167499 no
Casing Pileal_Stipeal_shell 0.042692 yes
Casing DIF_stipe_center 0.091835 no
Casing DIF_stipe_shell 0.194842 no
Casing DIF_stipe_skin 0.066395 no
Casing DIF_cap_skin 0.033444 yes
Casing DIF_cap_tissue 0.070137 no
DIF_gill_tissue YFB_stipe_center 0.927369 no
DIF_gill_tissue YFB_stipe_shell 0.769092 no
DIF_gill_tissue YFB_stipe_skin 0.931229 no
DIF_gill_tissue YFB_cap_skin 0.712426 no
DIF_gill_tissue YFB_cap_tissue 0.879967 no
DIF_gill_tissue YFB_gill_tissue 0.946926 no
DIF_gill_tissue YFB_veil 0.967740 no
YFB_stipe_center YFB_stipe_shell 0.654502 no
YFB_stipe_center YFB_stipe_skin 0.997502 no
YFB_stipe_center YFB_cap_skin 0.822018 no
YFB_stipe_center YFB_cap_tissue 0.960706 no
YFB_stipe_center YFB_gill_tissue 0.862994 no
YFB_stipe_center YFB_veil 0.961776 no
YFB_stipe_shell YFB_stipe_skin 0.660958 no
YFB_stipe_shell YFB_cap_skin 0.415294 no
YFB_stipe_shell YFB_cap_tissue 0.589465 no
YFB_stipe_shell YFB_gill_tissue 0.855942 no
YFB_stipe_shell YFB_veil 0.718839 no
YFB_stipe_skin YFB_cap_skin 0.817912 no
YFB_stipe_skin YFB_cap_tissue 0.958652 no
YFB_stipe_skin YFB_gill_tissue 0.865562 no
YFB_stipe_skin YFB_veil 0.964055 no
YFB_cap_skin YFB_cap_tissue 0.876641 no
YFB_cap_skin YFB_gill_tissue 0.632094 no
YFB_cap_skin YFB_veil 0.765500 no
YFB_cap_tissue YFB_gill_tissue 0.810385 no
YFB_cap_tissue YFB_veil 0.919628 no
YFB_gill_tissue YFB_veil 0.909804 no
Initials DIF_gill_tissue 0.211808 no
Initials YFB_stipe_center 0.148238 no
Initials YFB_stipe_shell 0.482998 no
Initials YFB_stipe_skin 0.149896 no
Initials YFB_cap_skin 0.061277 no
Initials YFB_cap_tissue 0.120367 no
Initials YFB_gill_tissue 0.284348 no
Initials YFB_veil 0.179329 no
Initials Pileal_Stipeal_center 0.262277 no
Initials Pileal_Stipeal_shell 0.087080 no
Initials DIF_stipe_center 0.162633 no
Initials DIF_stipe_shell 0.295530 no
Initials DIF_stipe_skin 0.123208 no
Initials DIF_cap_skin 0.066395 no
Initials DIF_cap_tissue 0.130818 no
Pileal_Stipeal_center DIF_gill_tissue 0.955539 no
Pileal_Stipeal_center YFB_stipe_center 0.872362 no
Pileal_Stipeal_center YFB_stipe_shell 0.840190 no
Pileal_Stipeal_center YFB_stipe_skin 0.876963 no
Pileal_Stipeal_center YFB_cap_skin 0.638245 no
Pileal_Stipeal_center YFB_cap_tissue 0.814489 no
Pileal_Stipeal_center YFB_gill_tissue 0.991483 no
Pileal_Stipeal_center YFB_veil 0.919450 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.734649 no
Pileal_Stipeal_center DIF_stipe_center 0.893765 no
Pileal_Stipeal_center DIF_stipe_shell 0.984235 no
Pileal_Stipeal_center DIF_stipe_skin 0.820445 no
Pileal_Stipeal_center DIF_cap_skin 0.660922 no
Pileal_Stipeal_center DIF_cap_tissue 0.845344 no
Pileal_Stipeal_shell DIF_gill_tissue 0.808850 no
Pileal_Stipeal_shell YFB_stipe_center 0.901721 no
Pileal_Stipeal_shell YFB_stipe_shell 0.504265 no
Pileal_Stipeal_shell YFB_stipe_skin 0.899325 no
Pileal_Stipeal_shell YFB_cap_skin 0.939747 no
Pileal_Stipeal_shell YFB_cap_tissue 0.945512 no
Pileal_Stipeal_shell YFB_gill_tissue 0.730163 no
Pileal_Stipeal_shell YFB_veil 0.851477 no
Pileal_Stipeal_shell DIF_stipe_center 0.879740 no
Pileal_Stipeal_shell DIF_stipe_shell 0.715156 no
Pileal_Stipeal_shell DIF_stipe_skin 0.942251 no
Pileal_Stipeal_shell DIF_cap_skin 0.955977 no
Pileal_Stipeal_shell DIF_cap_tissue 0.923797 no
DIF_stipe_center DIF_gill_tissue 0.946949 no
DIF_stipe_center YFB_stipe_center 0.981167 no
DIF_stipe_center YFB_stipe_shell 0.684881 no
DIF_stipe_center YFB_stipe_skin 0.985066 no
DIF_stipe_center YFB_cap_skin 0.793770 no
DIF_stipe_center YFB_cap_tissue 0.941566 no
DIF_stipe_center YFB_gill_tissue 0.883721 no
DIF_stipe_center YFB_veil 0.979582 no
DIF_stipe_center DIF_stipe_shell 0.872221 no
DIF_stipe_center DIF_stipe_skin 0.944917 no
DIF_stipe_center DIF_cap_skin 0.816867 no
DIF_stipe_center DIF_cap_tissue 0.963923 no
DIF_stipe_shell DIF_gill_tissue 0.939747 no
DIF_stipe_shell YFB_stipe_center 0.852643 no
DIF_stipe_shell YFB_stipe_shell 0.863313 no
DIF_stipe_shell YFB_stipe_skin 0.857647 no
DIF_stipe_shell YFB_cap_skin 0.619249 no
DIF_stipe_shell YFB_cap_tissue 0.791296 no
DIF_stipe_shell YFB_gill_tissue 0.992528 no
DIF_stipe_shell YFB_veil 0.900519 no
DIF_stipe_shell DIF_stipe_skin 0.798261 no
DIF_stipe_shell DIF_cap_skin 0.642526 no
DIF_stipe_shell DIF_cap_tissue 0.826017 no
DIF_stipe_skin DIF_gill_tissue 0.886337 no
DIF_stipe_skin YFB_stipe_center 0.963779 no
DIF_stipe_skin YFB_stipe_shell 0.593967 no
DIF_stipe_skin YFB_stipe_skin 0.963204 no
DIF_stipe_skin YFB_cap_skin 0.873063 no
DIF_stipe_skin YFB_cap_tissue 0.997042 no
DIF_stipe_skin YFB_gill_tissue 0.812614 no
DIF_stipe_skin YFB_veil 0.923685 no
DIF_stipe_skin DIF_cap_skin 0.892252 no
DIF_stipe_skin DIF_cap_tissue 0.983554 no
DIF_cap_skin DIF_gill_tissue 0.739028 no
DIF_cap_skin YFB_stipe_center 0.846467 no
DIF_cap_skin YFB_stipe_shell 0.431906 no
DIF_cap_skin YFB_stipe_skin 0.845162 no
DIF_cap_skin YFB_cap_skin 0.984032 no
DIF_cap_skin YFB_cap_tissue 0.895275 no
DIF_cap_skin YFB_gill_tissue 0.656433 no
DIF_cap_skin YFB_veil 0.788488 no
DIF_cap_skin DIF_cap_tissue 0.869696 no
DIF_cap_tissue DIF_gill_tissue 0.907075 no
DIF_cap_tissue YFB_stipe_center 0.980624 no
DIF_cap_tissue YFB_stipe_shell 0.627081 no
DIF_cap_tissue YFB_stipe_skin 0.980027 no
DIF_cap_tissue YFB_cap_skin 0.851318 no
DIF_cap_tissue YFB_cap_tissue 0.979873 no
DIF_cap_tissue YFB_gill_tissue 0.839383 no
DIF_cap_tissue YFB_veil 0.943502 no

Orthologs

Orthofinder run ID1
Orthogroup173
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024140
Agaricus bisporus var bisporus H39 AgabiH39|306500
Agaricus bisporus var bisporus H39 AgabiH39|306300
Agaricus bisporus var bisporus H39 AgabiH39|306000
Agaricus bisporus var bisporus H39 AgabiH39|305800
Agaricus bisporus var bisporus H39 AgabiH39|305600
Agaricus bisporus var bisporus H39 AgabiH39|305100
Agaricus bisporus var bisporus H39 AgabiH39|304500
Agaricus bisporus var bisporus H39 AgabiH39|301800
Agaricus bisporus var bisporus H39 AgabiH39|234900
Agaricus bisporus var bisporus H39 AgabiH39|305300
Agaricus bisporus var bisporus H39 AgabiH39|107580
Agaricus bisporus var bisporus H39 AgabiH39|117180
Agaricus bisporus var bisporus H39 AgabiH39|029320
Agaricus bisporus var bisporus H39 AgabiH39|029390
Agaricus bisporus var bisporus H39 AgabiH39|065210
Agaricus bisporus var bisporus H39 AgabiH39|027140
Agaricus bisporus var bisporus H39 AgabiH39|080500
Agaricus bisporus var bisporus H39 AgabiH39|099320
Agaricus bisporus var bisporus H39 AgabiH39|107550
Agaricus bisporus var bisporus H39 AgabiH39|065350
Agaricus bisporus var bisporus H97 AgabiH97|065140
Agaricus bisporus var bisporus H97 AgabiH97|107550
Agaricus bisporus var bisporus H97 AgabiH97|099320
Agaricus bisporus var bisporus H97 AgabiH97|080500
Agaricus bisporus var bisporus H97 AgabiH97|065350
Agaricus bisporus var bisporus H97 AgabiH97|065250
Agaricus bisporus var bisporus H97 AgabiH97|065210
Agaricus bisporus var bisporus H97 AgabiH97|065200
Agaricus bisporus var bisporus H97 AgabiH97|065170
Agaricus bisporus var bisporus H97 AgabiH97|065120
Agaricus bisporus var bisporus H97 AgabiH97|014580
Agaricus bisporus var bisporus H97 AgabiH97|065040
Agaricus bisporus var bisporus H97 AgabiH97|064700
Agaricus bisporus var bisporus H97 AgabiH97|064190
Agaricus bisporus var bisporus H97 AgabiH97|029390
Agaricus bisporus var bisporus H97 AgabiH97|029320
Agaricus bisporus var bisporus H97 AgabiH97|027140
Agaricus bisporus var bisporus H97 AgabiH97|024140 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|023550
Agaricus bisporus var bisporus H97 AgabiH97|107580
Agaricus bisporus var bisporus H97 AgabiH97|065070
Agaricus bisporus var bisporus H97 AgabiH97|117180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024140
MFSLVYFTTLVLGFAAPAIAFPAHGSLAGLSREEMDKALATLKFTPPPPPPGPLDFSGTKLVNDAKHPFMDARPG
DIRGPCPGLNTLASHGYISRTGITSCSEIITAVMEGV*
Coding >AgabiH97|024140
ATGTTCAGTCTTGTATACTTCACCACTCTTGTCCTGGGTTTTGCTGCTCCCGCTATCGCCTTTCCGGCACATGGA
TCTTTGGCTGGATTGTCAAGAGAAGAGATGGACAAAGCATTGGCCACGCTCAAATTTACCCCTCCGCCACCTCCT
CCCGGTCCGCTGGATTTCAGTGGCACCAAGCTTGTCAATGACGCCAAACATCCTTTCATGGATGCGAGACCAGGC
GACATTCGTGGACCATGCCCAGGCTTGAATACACTCGCTTCCCATGGGTATATAAGTCGCACTGGAATTACCAGC
TGTTCAGAGATCATCACTGCAGTGATGGAAGGTGTGTAA
Transcript >AgabiH97|024140
ATGTTCAGTCTTGTATACTTCACCACTCTTGTCCTGGGTTTTGCTGCTCCCGCTATCGCCTTTCCGGCACATGGA
TCTTTGGCTGGATTGTCAAGAGAAGAGATGGACAAAGCATTGGCCACGCTCAAATTTACCCCTCCGCCACCTCCT
CCCGGTCCGCTGGATTTCAGTGGCACCAAGCTTGTCAATGACGCCAAACATCCTTTCATGGATGCGAGACCAGGC
GACATTCGTGGACCATGCCCAGGCTTGAATACACTCGCTTCCCATGGGTATATAAGTCGCACTGGAATTACCAGC
TGTTCAGAGATCATCACTGCAGTGATGGAAGGTGTGTAA
Gene >AgabiH97|024140
ATGTTCAGTCTTGTATACTTCACCACTCTTGTCCTGGGTTTTGCTGCTCCCGCTATCGCCTTTCCGGCACATGGA
TCTTTGGCTGGATTGTCAAGAGAAGAGATGGACAAAGCATTGGCCACGCTCAAATTTACCCCTCCGCCACCTCCT
CCCGGTCCGCTGGATTTCAGTGGCACCAAGCTTGTCAATGACGCCAAACATCCTTTCATGGATGCGAGACCAGGC
GACATTCGTGGACCATGCCCAGGCTTGAATACACTCGCTTCCCATGGGGTTCGTATTGTTTTTCAAGTTTGCTTC
GGGCTGCAATCTGACCGCTTTCTATAGTATATAAGTCGCACTGGAATTACCAGCTGTTCAGAGATCATCACTGCA
GTGATGGAAGGTGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail