Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024120
Gene name
Locationscaffold_11:671835..673116
Strand-
Gene length (bp)1281
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 9.6E-24 61 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1 114 271 2.0E-11
sp|Q6P6J4|ALKB2_MOUSE DNA oxidative demethylase ALKBH2 OS=Mus musculus GN=Alkbh2 PE=1 SV=1 114 271 3.0E-09
sp|Q58DM4|ALKB2_BOVIN DNA oxidative demethylase ALKBH2 OS=Bos taurus GN=ALKBH2 PE=2 SV=1 114 271 2.0E-08
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 73 271 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024120
MHLMQTYDHNVPILNPWPTPLLSDSICIVQQQIRELSEPFSALRNDDDYKSFEAFSELAGDAYAKLVEEVDWIKM
LHRGGEVPRLVAQQGEIIDEDGSYPIYRHPADESPPLLPFTPTVQLIRDHVQKVLNHPVNHVLIQHYRTGADYIS
DHSDKTIDINRHSFIVNVSLGAQRVMTLRQKKDKNAREQERHAPSTPTSSTSTDSTSHHTQPPPRPTQRIPLPDN
SLFILGLETNKKWLHGISTDKRPLSTKTPVEQINNGARISLTFRWIGTFVNPTRNTIWGIGARAKNREDAKTILD
GTTNATGMKDAENLITAFGEENFDPDFDWEKWYGEGFDVLHFKVN*
Coding >AgabiH97|024120
ATGCATCTGATGCAGACTTACGATCATAATGTGCCTATTCTAAATCCTTGGCCAACACCACTTCTCTCCGACTCT
ATCTGCATAGTACAACAGCAAATACGTGAACTATCCGAACCATTCTCAGCACTAAGAAATGACGACGACTACAAG
AGCTTCGAGGCCTTCTCTGAGCTGGCTGGAGATGCTTATGCAAAGTTGGTTGAGGAAGTTGACTGGATCAAGATG
CTGCATCGCGGAGGAGAAGTACCGAGATTAGTTGCACAGCAAGGCGAAATCATAGATGAAGACGGGAGCTATCCG
ATATATCGTCATCCTGCAGATGAATCACCCCCACTGTTACCGTTCACACCTACAGTTCAACTTATTCGCGACCAC
GTCCAAAAAGTTCTAAATCACCCGGTGAACCACGTCCTAATCCAACATTACCGCACCGGAGCGGATTACATCTCA
GACCACTCTGACAAGACCATTGACATCAATCGCCATTCATTCATCGTCAACGTCAGTCTAGGTGCTCAACGTGTT
ATGACACTTCGTCAAAAGAAAGATAAAAACGCCAGAGAACAAGAACGACATGCTCCGTCAACACCGACCTCTTCC
ACCAGTACCGACTCAACATCCCATCATACTCAACCACCACCTCGCCCAACTCAACGCATCCCTCTCCCCGATAAT
TCCTTGTTCATACTCGGCCTTGAAACGAATAAAAAATGGCTTCACGGAATATCCACCGACAAACGTCCACTCTCA
ACCAAAACCCCCGTCGAACAAATCAACAACGGTGCCCGCATTAGTCTCACTTTCCGTTGGATCGGCACCTTTGTC
AATCCAACTCGAAACACCATTTGGGGTATCGGCGCACGAGCAAAGAACCGCGAAGACGCTAAAACCATTTTAGAT
GGTACAACAAATGCTACTGGTATGAAAGACGCTGAGAACCTGATAACGGCTTTTGGCGAGGAGAATTTTGATCCG
GACTTTGATTGGGAAAAGTGGTACGGAGAAGGATTTGATGTGCTACATTTCAAAGTAAATTAA
Transcript >AgabiH97|024120
ATGCATCTGATGCAGACTTACGATCATAATGTGCCTATTCTAAATCCTTGGCCAACACCACTTCTCTCCGACTCT
ATCTGCATAGTACAACAGCAAATACGTGAACTATCCGAACCATTCTCAGCACTAAGAAATGACGACGACTACAAG
AGCTTCGAGGCCTTCTCTGAGCTGGCTGGAGATGCTTATGCAAAGTTGGTTGAGGAAGTTGACTGGATCAAGATG
CTGCATCGCGGAGGAGAAGTACCGAGATTAGTTGCACAGCAAGGCGAAATCATAGATGAAGACGGGAGCTATCCG
ATATATCGTCATCCTGCAGATGAATCACCCCCACTGTTACCGTTCACACCTACAGTTCAACTTATTCGCGACCAC
GTCCAAAAAGTTCTAAATCACCCGGTGAACCACGTCCTAATCCAACATTACCGCACCGGAGCGGATTACATCTCA
GACCACTCTGACAAGACCATTGACATCAATCGCCATTCATTCATCGTCAACGTCAGTCTAGGTGCTCAACGTGTT
ATGACACTTCGTCAAAAGAAAGATAAAAACGCCAGAGAACAAGAACGACATGCTCCGTCAACACCGACCTCTTCC
ACCAGTACCGACTCAACATCCCATCATACTCAACCACCACCTCGCCCAACTCAACGCATCCCTCTCCCCGATAAT
TCCTTGTTCATACTCGGCCTTGAAACGAATAAAAAATGGCTTCACGGAATATCCACCGACAAACGTCCACTCTCA
ACCAAAACCCCCGTCGAACAAATCAACAACGGTGCCCGCATTAGTCTCACTTTCCGTTGGATCGGCACCTTTGTC
AATCCAACTCGAAACACCATTTGGGGTATCGGCGCACGAGCAAAGAACCGCGAAGACGCTAAAACCATTTTAGAT
GGTACAACAAATGCTACTGGTATGAAAGACGCTGAGAACCTGATAACGGCTTTTGGCGAGGAGAATTTTGATCCG
GACTTTGATTGGGAAAAGTGGTACGGAGAAGGATTTGATGTGCTACATTTCAAAGTAAATTAA
Gene >AgabiH97|024120
ATGCATCTGATGCAGACTTACGATCATAATGTGCCTATTCTAAATCCTTGGCCAACACCACTTCTCTCCGACTCT
ATCTGCATAGTACAACAGCAAATACGTGAACTATCCGAACCATTCTCAGCACTAAGAAATGACGACGACTACAAG
AGCTTCGAGGCCTTCTCTGGTAGATCCACAAGAGCCACTAGGGTCTGGTGACTCACGCGTGGTTTATGACTTGTT
ACCCTCAGAGCTGGCTGGAGATGCTTATGCAAAGTTGGTTGAGGAAGTTGACTGGATCAAGATGCTGCATCGCGG
TACGTTGTGTATTTTACCGTATATAACTCGAAATCGTATTGATTGTGAGGTATTCATAGGAGGAGAAGTACCGAG
ATTAGTTGCACAGCAAGGCGAAATCATAGATGAAGACGGGAGGTGAGTTTTGTTTCGTCGCTTAAACTGAATGAG
CTGCCAGGTTAAGTGATGATTTAGCTATCCGATATATCGTCATCCTGCAGATGAATCACCCCCACTGTTACCGTT
CACACCTACAGTTCAACTTATTCGCGACCACGTCCAAAAAGTAAGCGATTCTAAAACAAAATCGCAAAACCTCGC
CGCTGATTACTCTTTATTGATTCCAAGGTTCTAAATCACCCGGTGAACCACGTCCTAATCCAACATTACCGCACC
GGAGCGGATTACATCTCAGACCACTCTGACAAGACCATTGACATCAATCGCCATTCATTCATCGTCAACGTCAGT
CTAGGTGCTCAACGTGTTATGACACTTCGTCAAAAGAAAGATAAAAACGCCAGAGAACAAGAACGACATGCTCCG
TCAACACCGACCTCTTCCACCAGTACCGACTCAACATCCCATCATACTCAACCACCACCTCGCCCAACTCAACGC
ATCCCTCTCCCCGATAATTCCTTGTTCATACTCGGCCTTGAAACGAATAAAAAATGGCTTCACGGAATATCCACC
GACAAACGTCCACTCTCAACCAAAACCCCCGTCGAACAAATCAACAACGGTGCCCGCATTAGTCTCACTTTCCGT
TGGATCGGCACCTTTGTCAATCCAACTCGAAACACCATTTGGGGTATCGGCGCACGAGCAAAGAACCGCGAAGAC
GCTAAAACCATTTTAGATGGTACAACAAATGCTACTGGTATGAAAGACGCTGAGAACCTGATAACGGCTTTTGGC
GAGGAGAATTTTGATCCGGACTTTGATTGGGAAAAGTGGTACGGAGAAGGATTTGATGTGCTACATTTCAAAGTA
AATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail