Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|024090
Gene name
Locationscaffold_11:661871..663374
Strand-
Gene length (bp)1503
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 1.4E-28 129 336
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.8E-07 162 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FP82|M28P2_ARTOC Probable zinc metalloprotease MCYG_04217 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04217 PE=3 SV=1 27 459 0.0E+00
sp|D4D8N9|M28P2_TRIVH Probable zinc metalloprotease TRV_03476 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03476 PE=3 SV=1 32 459 1.0E-177
sp|E3RJ99|M28P2_PYRTT Probable zinc metalloprotease PTT_08196 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_08196 PE=3 SV=1 28 460 1.0E-175
sp|C4JHZ6|M28P2_UNCRE Probable zinc metalloprotease UREG_01421 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01421 PE=3 SV=1 37 460 2.0E-175
sp|D4AM42|M28P2_ARTBC Probable zinc metalloprotease ARB_04732 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04732 PE=3 SV=1 32 459 4.0E-174
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FP82|M28P2_ARTOC Probable zinc metalloprotease MCYG_04217 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04217 PE=3 SV=1 27 459 0.0E+00
sp|D4D8N9|M28P2_TRIVH Probable zinc metalloprotease TRV_03476 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03476 PE=3 SV=1 32 459 1.0E-177
sp|E3RJ99|M28P2_PYRTT Probable zinc metalloprotease PTT_08196 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_08196 PE=3 SV=1 28 460 1.0E-175
sp|C4JHZ6|M28P2_UNCRE Probable zinc metalloprotease UREG_01421 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01421 PE=3 SV=1 37 460 2.0E-175
sp|D4AM42|M28P2_ARTBC Probable zinc metalloprotease ARB_04732 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04732 PE=3 SV=1 32 459 4.0E-174
sp|B2W3C7|M28P2_PYRTR Probable zinc metalloprotease PTRG_04977 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04977 PE=3 SV=1 28 459 6.0E-174
sp|E4URG0|M28P2_ARTGP Probable zinc metalloprotease MGYG_02393 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02393 PE=3 SV=1 27 459 9.0E-174
sp|E5A6Z0|M28P2_LEPMJ Probable zinc metalloprotease Lema_P086240 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P086240 PE=3 SV=1 40 459 8.0E-170
sp|A4R017|M28P2_MAGO7 Probable zinc metalloprotease MGG_02107 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02107 PE=3 SV=1 28 459 1.0E-163
sp|Q0UNS4|M28P3_PHANO Probable zinc metalloprotease SNOG_06590 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_06590 PE=3 SV=2 1 459 3.0E-151
sp|E5R501|M28P3_LEPMJ Probable zinc metalloprotease Lema_P049800 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P049800 PE=3 SV=1 1 459 3.0E-147
sp|B2W572|M28P3_PYRTR Probable zinc metalloprotease PTRG_04772 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_04772 PE=3 SV=1 40 459 2.0E-145
sp|E3S5D4|M28P3_PYRTT Probable zinc metalloprotease PTT_17836 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_17836 PE=3 SV=1 1 459 1.0E-135
sp|C9SPU8|M28P3_VERA1 Probable zinc metalloprotease VDBG_06923 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_06923 PE=3 SV=1 157 460 3.0E-119
sp|Q01693|AMPX_VIBPR Bacterial leucyl aminopeptidase OS=Vibrio proteolyticus PE=1 SV=1 48 230 3.0E-16
sp|B2B3P6|LAP1_PODAN Leucine aminopeptidase 1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=LAP1 PE=3 SV=1 30 380 3.0E-14
sp|C6HH71|LAP1_AJECH Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H143) GN=LAP1 PE=3 SV=1 44 241 7.0E-11
sp|F0URV0|LAP1_AJEC8 Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain H88) GN=LAP1 PE=3 SV=1 44 241 7.0E-11
sp|A7ETG2|LAP1_SCLS1 Leucine aminopeptidase 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lap1 PE=3 SV=1 37 374 3.0E-10
sp|C0NVM2|LAP1_AJECG Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=LAP1 PE=3 SV=1 44 241 3.0E-10
sp|A4R640|LAP1_MAGO7 Leucine aminopeptidase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LAP1 PE=3 SV=1 47 373 4.0E-10
sp|F0X8C8|LAP1_GROCL Leucine aminopeptidase 1 OS=Grosmannia clavigera (strain kw1407 / UAMH 11150) GN=LAP1 PE=3 SV=1 30 374 4.0E-10
sp|A6REE0|LAP1_AJECN Leucine aminopeptidase 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=LAP1 PE=3 SV=1 44 241 7.0E-10
sp|Q2H1T8|LAP1_CHAGB Leucine aminopeptidase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LAP1 PE=3 SV=1 33 372 1.0E-09
sp|C5FLR8|LAP4_ARTOC Probable leucine aminopeptidase MCYG_03459 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03459 PE=3 SV=1 44 377 1.0E-09
sp|Q7RYC8|LAP1_NEUCR Leucine aminopeptidase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lap1 PE=3 SV=1 33 374 2.0E-09
sp|C1GMY8|LAP1_PARBD Leucine aminopeptidase 1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=LAP1 PE=3 SV=1 37 374 4.0E-09
sp|A7UI11|LAP1_TRIEQ Leucine aminopeptidase 1 OS=Trichophyton equinum GN=LAP1 PE=3 SV=1 47 363 5.0E-09
sp|B6V870|LAP1_TRITO Probable leucine aminopeptidase 1 OS=Trichophyton tonsurans GN=LAP1 PE=3 SV=2 47 363 5.0E-09
sp|D4AZ23|LAP4_ARTBC Probable leucine aminopeptidase ARB_01443 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01443 PE=3 SV=1 47 377 6.0E-09
sp|C7Z6W1|LAP1_NECH7 Leucine aminopeptidase 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=LAP1 PE=3 SV=1 33 231 2.0E-08
sp|C4JLL1|LAP1_UNCRE Leucine aminopeptidase 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=LAP1 PE=3 SV=1 42 235 3.0E-08
sp|P25152|BSAP_BACSU Aminopeptidase YwaD OS=Bacillus subtilis (strain 168) GN=ywaD PE=1 SV=2 139 357 4.0E-08
sp|A1C948|LAP1_ASPCL Leucine aminopeptidase 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lap1 PE=3 SV=1 43 375 7.0E-08
sp|E9F277|LAP1_METRA Leucine aminopeptidase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=LAP1 PE=3 SV=1 33 235 7.0E-08
sp|E3S6P9|LAP1_PYRTT Leucine aminopeptidase 1 OS=Pyrenophora teres f. teres (strain 0-1) GN=lap1 PE=3 SV=1 37 374 8.0E-08
sp|A1D9K5|LAP1_NEOFI Leucine aminopeptidase 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lap1 PE=3 SV=1 15 375 4.0E-07
sp|D4B528|LAP1_ARTBC Probable leucine aminopeptidase 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=LAP1 PE=1 SV=1 129 363 5.0E-07
sp|E9DUF4|LAP1_METAQ Leucine aminopeptidase 1 OS=Metarhizium acridum (strain CQMa 102) GN=LAP1 PE=3 SV=1 42 235 5.0E-07
sp|C5G0A8|LAP3_ARTOC Probable leucine aminopeptidase MCYG_08380 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08380 PE=3 SV=1 47 374 5.0E-07
sp|Q5VJG6|LAP1_ASPFM Leucine aminopeptidase 1 OS=Neosartorya fumigata GN=lap1 PE=3 SV=1 15 375 7.0E-07
sp|B0YED6|LAP1_ASPFC Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lap1 PE=3 SV=2 15 375 7.0E-07
sp|Q4W9P4|LAP1_ASPFU Leucine aminopeptidase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lap1 PE=3 SV=2 15 375 7.0E-07
sp|D4DHE3|LAP1_TRIVH Probable leucine aminopeptidase 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=LAP1 PE=3 SV=1 129 363 7.0E-07
sp|E4V655|LAP1_ARTGP Leucine aminopeptidase 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=LAP1 PE=3 SV=1 47 363 9.0E-07
sp|Q04033|YD415_YEAST Probable aminopeptidase YDR415C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR415C PE=3 SV=1 28 231 1.0E-06
sp|Q2U1F3|LAPA_ASPOR Leucine aminopeptidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lapA PE=1 SV=1 163 257 1.0E-06
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 125 212 2.0E-06
sp|B6H3H1|LAP1_PENRW Leucine aminopeptidase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lap1 PE=3 SV=1 39 375 2.0E-06
sp|D4AWL0|LAP5_ARTBC Probable leucine aminopeptidase ARB_00576 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00576 PE=3 SV=1 43 231 2.0E-06
sp|Q5QHG5|LAP1_TRIRU Leucine aminopeptidase 1 OS=Trichophyton rubrum GN=LAP1 PE=1 SV=1 129 363 3.0E-06
sp|C5FFM0|LAP1_ARTOC Leucine aminopeptidase 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=LAP1 PE=3 SV=1 47 363 3.0E-06
sp|E4ZHQ5|LAP1_LEPMJ Leucine aminopeptidase 1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=LAP1 PE=3 SV=1 47 231 3.0E-06
sp|C1HC91|LAP1_PARBA Leucine aminopeptidase 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=LAP1 PE=3 SV=1 12 374 6.0E-06
sp|Q8J2N2|LAP1_ASPSO Leucine aminopeptidase 1 OS=Aspergillus sojae GN=lap1 PE=1 SV=1 44 235 7.0E-06
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 125 212 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|024090
MKSLALLSLCGLFAICTAQRSPFEPLWPDGPGKKVTPQEPSRELEKILSNIDPDRIRQTITKLVSFGTRHTLSSQ
TDPNRGIGAARDWIASEMQTYADASHGRMKISTPSYIQEPDGDRVLFPVKISDVVATLEGSVEPNRVYVVSGHYD
NRVSDPLNFMDDAPGADDDASGVAVSMELARVMASHKPDATIMFVAVAGEEQGLYGSQHLADLMKNTSTDVQGMF
DNDIVGSPVGDDGHSDPFIIRMFSSGIPPTATFDEVTRIADLGGENDSPSRELSRFMAEVAQNHATKMRVQSIWR
PDRFLRSGDHIPFLENGFPALRFTEPNENFAHQHQDIRVEDGKQFGDLIEFVDFEYISRVAKVNGAGLWSLANAP
GVPRGATILANTLGNNSTFTWTDDPNAHSYEIVWRPTDQAFWTHAIPVGKVTSATVMLSKDNVNFGIRAVGKNGL
KSPAAFPVPSSSD*
Coding >AgabiH97|024090
ATGAAATCCCTTGCATTGCTCAGTCTATGCGGATTATTCGCAATCTGTACTGCCCAGCGATCTCCCTTTGAACCT
CTCTGGCCCGATGGTCCCGGTAAGAAAGTCACCCCTCAGGAACCGAGCCGAGAACTCGAGAAAATCCTTTCCAAC
ATCGATCCCGACCGTATCCGGCAAACCATCACCAAATTGGTCTCCTTCGGCACCCGTCACACACTCTCCAGTCAA
ACCGATCCCAATCGCGGTATCGGCGCCGCTCGTGACTGGATCGCATCCGAAATGCAGACCTACGCAGATGCTTCA
CATGGGCGCATGAAAATCTCTACGCCTAGCTATATCCAGGAACCTGATGGGGATCGAGTCCTTTTTCCCGTCAAA
ATCTCGGACGTCGTAGCCACACTTGAAGGCTCCGTGGAGCCTAATCGCGTCTACGTCGTGTCAGGACACTATGAT
AATCGAGTTTCGGATCCCTTGAACTTTATGGATGATGCTCCCGGAGCGGATGACGACGCATCCGGCGTTGCAGTT
TCCATGGAGCTCGCTCGTGTTATGGCGTCTCACAAGCCTGACGCTACCATAATGTTCGTAGCTGTGGCGGGAGAA
GAGCAAGGTCTATATGGCTCGCAGCATCTTGCTGATCTGATGAAGAATACTAGTACGGATGTCCAGGGTATGTTC
GACAACGATATTGTTGGGAGCCCCGTTGGGGACGACGGTCATTCGGACCCGTTCATTATCCGGATGTTCTCTAGT
GGCATACCGCCAACGGCAACTTTTGATGAAGTCACCCGGATAGCAGATCTTGGAGGAGAGAACGATTCGCCATCT
AGAGAGCTTAGTCGGTTTATGGCCGAGGTTGCACAGAATCATGCAACCAAGATGCGAGTTCAGTCAATTTGGCGC
CCCGATCGATTTCTCCGCAGTGGCGATCATATTCCTTTCCTTGAAAACGGCTTTCCGGCTCTCCGCTTCACAGAA
CCAAACGAGAATTTCGCTCACCAACACCAGGATATTCGCGTTGAAGACGGAAAACAATTCGGAGACCTTATCGAA
TTCGTTGACTTCGAATACATCTCCCGTGTGGCTAAGGTCAACGGTGCTGGTCTATGGTCATTGGCAAACGCTCCC
GGAGTACCAAGAGGGGCGACAATATTGGCGAATACATTAGGGAACAATTCAACTTTCACTTGGACGGATGATCCC
AACGCGCATAGCTATGAAATTGTTTGGAGACCAACTGACCAAGCGTTCTGGACGCACGCTATCCCTGTCGGAAAA
GTAACCAGTGCCACCGTCATGTTGTCGAAGGATAATGTCAACTTTGGTATTCGAGCTGTTGGCAAGAATGGTTTG
AAAAGCCCGGCAGCCTTCCCAGTACCTAGTAGTAGTGATTAG
Transcript >AgabiH97|024090
ATGAAATCCCTTGCATTGCTCAGTCTATGCGGATTATTCGCAATCTGTACTGCCCAGCGATCTCCCTTTGAACCT
CTCTGGCCCGATGGTCCCGGTAAGAAAGTCACCCCTCAGGAACCGAGCCGAGAACTCGAGAAAATCCTTTCCAAC
ATCGATCCCGACCGTATCCGGCAAACCATCACCAAATTGGTCTCCTTCGGCACCCGTCACACACTCTCCAGTCAA
ACCGATCCCAATCGCGGTATCGGCGCCGCTCGTGACTGGATCGCATCCGAAATGCAGACCTACGCAGATGCTTCA
CATGGGCGCATGAAAATCTCTACGCCTAGCTATATCCAGGAACCTGATGGGGATCGAGTCCTTTTTCCCGTCAAA
ATCTCGGACGTCGTAGCCACACTTGAAGGCTCCGTGGAGCCTAATCGCGTCTACGTCGTGTCAGGACACTATGAT
AATCGAGTTTCGGATCCCTTGAACTTTATGGATGATGCTCCCGGAGCGGATGACGACGCATCCGGCGTTGCAGTT
TCCATGGAGCTCGCTCGTGTTATGGCGTCTCACAAGCCTGACGCTACCATAATGTTCGTAGCTGTGGCGGGAGAA
GAGCAAGGTCTATATGGCTCGCAGCATCTTGCTGATCTGATGAAGAATACTAGTACGGATGTCCAGGGTATGTTC
GACAACGATATTGTTGGGAGCCCCGTTGGGGACGACGGTCATTCGGACCCGTTCATTATCCGGATGTTCTCTAGT
GGCATACCGCCAACGGCAACTTTTGATGAAGTCACCCGGATAGCAGATCTTGGAGGAGAGAACGATTCGCCATCT
AGAGAGCTTAGTCGGTTTATGGCCGAGGTTGCACAGAATCATGCAACCAAGATGCGAGTTCAGTCAATTTGGCGC
CCCGATCGATTTCTCCGCAGTGGCGATCATATTCCTTTCCTTGAAAACGGCTTTCCGGCTCTCCGCTTCACAGAA
CCAAACGAGAATTTCGCTCACCAACACCAGGATATTCGCGTTGAAGACGGAAAACAATTCGGAGACCTTATCGAA
TTCGTTGACTTCGAATACATCTCCCGTGTGGCTAAGGTCAACGGTGCTGGTCTATGGTCATTGGCAAACGCTCCC
GGAGTACCAAGAGGGGCGACAATATTGGCGAATACATTAGGGAACAATTCAACTTTCACTTGGACGGATGATCCC
AACGCGCATAGCTATGAAATTGTTTGGAGACCAACTGACCAAGCGTTCTGGACGCACGCTATCCCTGTCGGAAAA
GTAACCAGTGCCACCGTCATGTTGTCGAAGGATAATGTCAACTTTGGTATTCGAGCTGTTGGCAAGAATGGTTTG
AAAAGCCCGGCAGCCTTCCCAGTACCTAGTAGTAGTGATTAG
Gene >AgabiH97|024090
ATGAAATCCCTTGCATTGCTCAGTCTATGCGGATTATTCGCAAGTCAGTTCGACAGTTTCTATCGTGAATAATCC
AACTGACCTGACTATGCAACTTACTAGTCTGTACTGCCCAGCGATCTCCCTTTGAACCTCTCTGGCCCGATGGTC
CCGGTAAGAAAGTCACCCCTCAGGAACCGAGCCGAGAACTCGAGAAAATCCTTTCCAACATCGATCCCGACCGTA
TCCGGCAAACCATCACCAAATTGGTCTCCTTCGGCACCCGTCACACACTCTCCAGTCAAACCGATCCCAATCGCG
GTATCGGCGCCGCTCGTGACTGGATCGCATCCGAAATGCAGACCTACGCAGATGCTTCACATGGGCGCATGAAAA
TCTCTACGCCTAGCTATATCCAGGAACCTGATGGGGATCGAGTCCTTTTTCCCGTCAAAATCTCGGACGTCGTAG
CCACACTTGAAGGCTCCGTGGAGCCTAATCGCGTCTACGTCGTGTCAGGACACTATGATAATCGAGTTTCGGATC
CCTTGAACTTTATGGATGATGCTCCCGGAGCGGATGACGACGCATCCGGCGTTGCAGTTTCCATGGAGCTCGCTC
GTGTTATGGCGTCTCACAAGCCTGACGCTACCATAATGTTCGTAGCTGTGGCGGGAGAAGAGCAAGGTCTATATG
GCTCGCAGCATCTTGCTGATCTGATGAAGAATACTAGTACGGATGTCCAGGGTATGTTCGACAACGATATTGTTG
GGAGCCCCGTTGGGGACGACGGTCATTCGGACCCGTTCATTATCCGGATGTTCTCTAGTGGCATACCGCCAACGG
CAACTTTTGATGAAGTCACCCGGATAGCAGATCTTGGAGGAGAGAACGATTCGCCATCTAGAGAGCTTAGTCGGT
TTATGGCCGAGGTTGCACAGAATCATGCAACCAAGATGCGAGGTAAGAAATTTCAGATCATCAAAGGTGATACAG
GACTCAACGGATTAAACAGTTCAGTCAATTTGGCGCCCCGATCGATTTCTCCGCAGTGGCGATCATATTCCTTTC
CTTGAAAACGGCTTTCCGGCTCTCCGCTTCACAGAACCAAACGAGAATTTCGCTCACCAACACCAGGATATTCGC
GTTGAAGACGGAAAACAATTCGGAGACCTTATCGAATTCGTTGACTTCGAATACATCTCCCGTGTGGCTAAGGTC
AACGGTGCTGGTCTATGGTCATTGGCAAACGCTCCCGGAGTACCAAGAGGGGCGACAATATTGGCGAATACATTA
GGGAACAATTCAACTTTCACTTGGACGGATGATCCCAACGCGCATAGCTATGAAATTGTTTGGAGACCAACTGAC
CAAGCGTTCTGGACGCACGCTATCCCTGTCGGAAAAGTAACCAGTGCCACCGTCATGTTGTCGAAGGATAATGTC
AACTTTGGTATTCGAGCTGTTGGCAAGAATGGTTTGAAAAGCCCGGCAGCCTTCCCAGTACCTAGTAGTAGTGAT
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail