Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023890
Gene name
Locationscaffold_11:613231..614289
Strand-
Gene length (bp)1058
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.6E-12 37 270
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.5E-12 39 282
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.0E-07 37 140

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 9 140 7.0E-07
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 9 140 7.0E-07
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 9 140 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023890
MTTVSQNPTKYDSRYVKSADGTEIYADACGNRSPNSPVLVLIHGAFMVKGAFDPIIEDPKWTSSVFFVRYDTRGH
GRSGKSTAEEAWESKRFSEDFEAVCSEFNVREAYVLGWSIGSAQFVDIMSYNTTVRINGFISVAGAIYLDPSVAK
RTARPLVFECAAALTAPSSTDVFQEGLLNFLHLCSDKLPTDLFRVLLEGMVLQPRAAAVWVHKRKQDPEKMLEAA
RAGKLPLLAIGGGKDKFLDEDGFKATYEELGWQRMTYRHLEDADHVPWVSSPEEFRDVVLAWLRELQPSAEETVE
GGFFPRLKNLLNWMMSR*
Coding >AgabiH97|023890
ATGACCACCGTCTCGCAGAATCCTACAAAGTATGACTCTCGCTACGTCAAGTCAGCAGACGGCACAGAGATCTAT
GCAGATGCATGCGGGAACCGTTCTCCGAATTCTCCAGTTCTCGTCTTGATTCACGGTGCTTTTATGGTCAAAGGC
GCATTTGACCCCATCATTGAGGATCCCAAATGGACGTCTAGTGTATTCTTTGTGCGATACGATACACGTGGGCAC
GGTAGAAGCGGCAAATCCACTGCGGAGGAAGCATGGGAATCCAAACGATTTTCAGAGGATTTCGAAGCTGTTTGC
AGTGAATTCAATGTTAGAGAAGCTTATGTGCTGGGATGGAGTATTGGTTCTGCTCAGTTTGTGGATATCATGAGC
TATAACACCACGGTTCGGATAAATGGCTTCATCAGCGTCGCAGGAGCTATATACCTCGATCCTTCCGTTGCCAAA
CGTACTGCCAGACCCTTGGTATTTGAATGCGCGGCGGCACTCACAGCTCCTTCTTCAACCGACGTCTTCCAAGAA
GGTTTACTAAATTTCCTTCATTTATGTTCTGATAAACTTCCGACCGACCTCTTCCGCGTTTTACTGGAGGGAATG
GTCCTTCAACCACGAGCAGCAGCTGTATGGGTGCACAAACGAAAACAAGACCCTGAGAAAATGCTAGAGGCGGCC
CGAGCTGGGAAGCTGCCACTTTTGGCTATCGGTGGCGGAAAGGATAAATTCTTGGATGAGGATGGATTCAAAGCA
ACATATGAAGAATTGGGATGGCAGAGGATGACCTACCGACATTTGGAAGACGCGGACCATGTTCCGTGGGTGTCT
TCTCCAGAAGAATTCAGAGATGTCGTATTAGCGTGGCTCAGGGAGTTGCAACCTAGTGCTGAAGAAACAGTGGAA
GGTGGTTTTTTTCCTCGGCTAAAAAATCTCTTGAATTGGATGATGTCGCGTTAA
Transcript >AgabiH97|023890
ATGACCACCGTCTCGCAGAATCCTACAAAGTATGACTCTCGCTACGTCAAGTCAGCAGACGGCACAGAGATCTAT
GCAGATGCATGCGGGAACCGTTCTCCGAATTCTCCAGTTCTCGTCTTGATTCACGGTGCTTTTATGGTCAAAGGC
GCATTTGACCCCATCATTGAGGATCCCAAATGGACGTCTAGTGTATTCTTTGTGCGATACGATACACGTGGGCAC
GGTAGAAGCGGCAAATCCACTGCGGAGGAAGCATGGGAATCCAAACGATTTTCAGAGGATTTCGAAGCTGTTTGC
AGTGAATTCAATGTTAGAGAAGCTTATGTGCTGGGATGGAGTATTGGTTCTGCTCAGTTTGTGGATATCATGAGC
TATAACACCACGGTTCGGATAAATGGCTTCATCAGCGTCGCAGGAGCTATATACCTCGATCCTTCCGTTGCCAAA
CGTACTGCCAGACCCTTGGTATTTGAATGCGCGGCGGCACTCACAGCTCCTTCTTCAACCGACGTCTTCCAAGAA
GGTTTACTAAATTTCCTTCATTTATGTTCTGATAAACTTCCGACCGACCTCTTCCGCGTTTTACTGGAGGGAATG
GTCCTTCAACCACGAGCAGCAGCTGTATGGGTGCACAAACGAAAACAAGACCCTGAGAAAATGCTAGAGGCGGCC
CGAGCTGGGAAGCTGCCACTTTTGGCTATCGGTGGCGGAAAGGATAAATTCTTGGATGAGGATGGATTCAAAGCA
ACATATGAAGAATTGGGATGGCAGAGGATGACCTACCGACATTTGGAAGACGCGGACCATGTTCCGTGGGTGTCT
TCTCCAGAAGAATTCAGAGATGTCGTATTAGCGTGGCTCAGGGAGTTGCAACCTAGTGCTGAAGAAACAGTGGAA
GGTGGTTTTTTTCCTCGGCTAAAAAATCTCTTGAATTGGATGATGTCGCGTTAA
Gene >AgabiH97|023890
ATGACCACCGTCTCGCAGAATCCTACAAAGTATGACTCTCGCTACGTCAAGTCAGCAGACGGCACAGAGATCTAT
GCAGATGCATGCGGGAACCGTTCTCCGAATTCTCCAGTTCTCGTCTTGATTCACGGTGCTTTTATGGTCAAAGGC
GCATTTGACCCCATCATTGAGGATCCCAAATGGACGTCTAGTGTATTCTTTGTAAGCTTGACAGGGGTATAGCGG
AAGCAAGGCTAAAACTTTCTTGATGATAGGTGCGATACGATACACGTGGGCACGGTAGAAGCGGCAAATCCACTG
CGGAGGAAGCATGGGAATCCAAACGATTTTCAGAGGATTTCGAAGCTGTTTGCAGTGAATTCAATGTTAGAGAAG
CTTATGTGCTGGGATGGAGTATTGGTTGTGCGTCATTGTTCAATACCGCGAGATACTACAACGCTAATGGGACAC
TAGCTGCTCAGTTTGTGGATATCATGAGCTATAACACCACGGTTCGGATAAATGGCTTCATCAGCGTCGCAGGAG
CTATATACCTCGATCCTTCCGTTGCCAAACGTACTGCCAGACCCTTGGTATTTGAATGCGCGGCGGCACTCACAG
CTCCTTCTTCAACCGACGTCTTCCAAGAAGGTTTACTAAATTTCCTTCATTTATGTTCTGATAAACTTCCGACCG
ACCTCTTCCGCGTTTTACTGGAGGGAATGGTCCTTCAACCACGAGCAGCAGCTGTATGGGTGCACAAACGAAAAC
AAGACCCTGAGAAAATGCTAGAGGCGGCCCGAGCTGGGAAGCTGCCACTTTTGGCTATCGGTGGCGGAAAGGATA
AATTCTTGGATGAGGATGGATTCAAAGCAACATATGAAGAATTGGGATGGCAGAGGATGACCTACCGACATTTGG
AAGACGCGGACCATGTTCCGTGGGTGTCTTCTCCAGAAGAATTCAGAGATGTCGTATTAGCGTGGCTCAGGGAGT
TGCAACCTAGTGCTGAAGAAACAGTGGAAGGTGGTTTTTTTCCTCGGCTAAAAAATCTCTTGAATTGGATGATGT
CGCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail