Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023870
Gene name
Locationscaffold_11:607913..608895
Strand+
Gene length (bp)982
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.4E-10 36 278
PF12146 Hydrolase_4 Serine aminopeptidase, S33 7.9E-08 35 148
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.7E-07 34 116

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023870
MTRDLEVNTSRFVKSADGTEIYTDATGNRSPSSPALVLVHGIFMNKGAFNPIFDDSKWTSSLFLVRYDTRGHGRS
GKSVAEEAWESKRFAEDFEAVCREFEVREAYVLGWSIGAAVLADIMTYTTSVKILGFINVAGVVSVDPSIKRRSS
RPLVREIGGILLSPPSVDAFHEALFQFLHICSDELSPELFRILLEGMVMQPRGVAVWAFKRKQNAEKMLQEARGG
RLPLLGISGLKDKSLIVEELKGELEDLGWKRMTYRYIQDADHIPWVSCAEEFREIVLTWIKELTP*
Coding >AgabiH97|023870
ATGACCAGAGACTTGGAAGTGAATACCTCTCGCTTCGTGAAGTCAGCTGATGGTACGGAAATATATACAGACGCG
ACGGGCAACCGCTCGCCAAGCTCCCCGGCCCTAGTTTTGGTCCATGGTATTTTCATGAACAAAGGCGCATTTAAT
CCTATCTTTGACGATTCCAAATGGACCTCTAGTCTATTCCTAGTGCGGTACGATACCCGTGGACATGGTAGAAGC
GGCAAATCGGTTGCCGAGGAAGCCTGGGAATCCAAACGGTTCGCGGAAGATTTTGAAGCTGTTTGCAGAGAGTTC
GAAGTAAGAGAAGCATATGTCTTGGGGTGGAGTATCGGTGCCGCTGTGCTCGCTGATATCATGACCTACACCACT
TCAGTTAAGATACTTGGCTTCATTAATGTCGCAGGAGTTGTATCCGTGGACCCTTCGATCAAACGACGCTCATCT
CGTCCACTGGTACGTGAAATCGGGGGTATACTCCTATCCCCTCCTTCCGTAGATGCCTTCCACGAAGCTTTATTT
CAATTCCTCCACATATGCTCTGACGAGCTCTCTCCAGAGCTCTTCCGCATTTTACTGGAAGGAATGGTCATGCAG
CCACGGGGAGTAGCAGTGTGGGCTTTTAAAAGAAAGCAGAATGCTGAGAAGATGTTGCAAGAGGCGCGAGGCGGG
AGACTTCCACTCCTGGGCATCAGCGGCTTAAAGGATAAGTCATTGATTGTCGAGGAATTGAAAGGAGAGTTGGAA
GACTTGGGGTGGAAAAGGATGACGTATCGGTATATACAAGACGCGGACCACATTCCGTGGGTGTCTTGTGCAGAA
GAGTTTAGAGAAATTGTATTGACGTGGATAAAGGAGTTAACGCCATAA
Transcript >AgabiH97|023870
ATGACCAGAGACTTGGAAGTGAATACCTCTCGCTTCGTGAAGTCAGCTGATGGTACGGAAATATATACAGACGCG
ACGGGCAACCGCTCGCCAAGCTCCCCGGCCCTAGTTTTGGTCCATGGTATTTTCATGAACAAAGGCGCATTTAAT
CCTATCTTTGACGATTCCAAATGGACCTCTAGTCTATTCCTAGTGCGGTACGATACCCGTGGACATGGTAGAAGC
GGCAAATCGGTTGCCGAGGAAGCCTGGGAATCCAAACGGTTCGCGGAAGATTTTGAAGCTGTTTGCAGAGAGTTC
GAAGTAAGAGAAGCATATGTCTTGGGGTGGAGTATCGGTGCCGCTGTGCTCGCTGATATCATGACCTACACCACT
TCAGTTAAGATACTTGGCTTCATTAATGTCGCAGGAGTTGTATCCGTGGACCCTTCGATCAAACGACGCTCATCT
CGTCCACTGGTACGTGAAATCGGGGGTATACTCCTATCCCCTCCTTCCGTAGATGCCTTCCACGAAGCTTTATTT
CAATTCCTCCACATATGCTCTGACGAGCTCTCTCCAGAGCTCTTCCGCATTTTACTGGAAGGAATGGTCATGCAG
CCACGGGGAGTAGCAGTGTGGGCTTTTAAAAGAAAGCAGAATGCTGAGAAGATGTTGCAAGAGGCGCGAGGCGGG
AGACTTCCACTCCTGGGCATCAGCGGCTTAAAGGATAAGTCATTGATTGTCGAGGAATTGAAAGGAGAGTTGGAA
GACTTGGGGTGGAAAAGGATGACGTATCGGTATATACAAGACGCGGACCACATTCCGTGGGTGTCTTGTGCAGAA
GAGTTTAGAGAAATTGTATTGACGTGGATAAAGGAGTTAACGCCATAA
Gene >AgabiH97|023870
ATGACCAGAGACTTGGAAGTGAATACCTCTCGCTTCGTGAAGTCAGCTGATGGTACGGAAATATATACAGACGCG
ACGGGCAACCGCTCGCCAAGCTCCCCGGCCCTAGTTTTGGTCCATGGTATTTTCATGAACAAAGGCGCATTTAAT
CCTATCTTTGACGATTCCAAATGGACCTCTAGTCTATTCCTAGTAAGCCAAGTTGGCAGCATGGTGAACGTGACT
GAAGCTCATGATACTGACAAGGTGCGGTACGATACCCGTGGACATGGTAGAAGCGGCAAATCGGTTGCCGAGGAA
GCCTGGGAATCCAAACGGTTCGCGGAAGATTTTGAAGCTGTTTGCAGAGAGTTCGAAGTAAGAGAAGCATATGTC
TTGGGGTGGAGTATCGGTGGTGGGCCATTTTCTTTGCTCGATACCAATAGACTCGGCTCTGATGACTTTTTCAGC
CGCTGTGCTCGCTGATATCATGACCTACACCACTTCAGTTAAGATACTTGGCTTCATTAATGTCGCAGGAGTTGT
ATCCGTGGACCCTTCGATCAAACGACGCTCATCTCGTCCACTGGTACGTGAAATCGGGGGTATACTCCTATCCCC
TCCTTCCGTAGATGCCTTCCACGAAGCTTTATTTCAATTCCTCCACATATGCTCTGACGAGCTCTCTCCAGAGCT
CTTCCGCATTTTACTGGAAGGAATGGTCATGCAGCCACGGGGAGTAGCAGTGTGGGCTTTTAAAAGAAAGCAGAA
TGCTGAGAAGATGTTGCAAGAGGCGCGAGGCGGGAGACTTCCACTCCTGGGCATCAGCGGCTTAAAGGATAAGTC
ATTGATTGTCGAGGAATTGAAAGGAGAGTTGGAAGACTTGGGGTGGAAAAGGATGACGTATCGGTATATACAAGA
CGCGGACCACATTCCGTGGGTGTCTTGTGCAGAAGAGTTTAGAGAAATTGTATTGACGTGGATAAAGGAGTTAAC
GCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail