Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023860
Gene name
Locationscaffold_11:606168..607268
Strand+
Gene length (bp)1100
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.0E-12 24 265
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.5E-07 23 137
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.5E-07 22 129

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023860
MQKKSINWREYLSLCEISRCTPVLVLVHGGFMCKEAFNPIFDDPKWTSSLFLVRYDARGHGRSGKSDTEEAWESK
RFAEDFEAVCREFEVREAYVLGWSIGAAVLADIMAYTTPVNILGFINVAGLVYVDPSVNSHVASRLAREWGPPFL
FPPSGDAFQESCSQFIHICSDEISPELFSILMEGMAMQPRGIAARVCVRKQNPENMLEEARGGRLPLLAISGLKD
KALYTEKLKGELEALGWKRMTYRYLQDADHIPWVSCAEEFREIVLTWMKELTP*
Coding >AgabiH97|023860
ATGCAAAAAAAATCTATAAATTGGCGTGAATACCTCTCGCTTTGTGAAATCAGCCGATGCACCCCAGTCCTCGTT
CTGGTCCATGGTGGTTTCATGTGCAAAGAAGCATTCAATCCTATCTTTGACGATCCCAAGTGGACCTCTAGCCTA
TTCCTAGTGCGATACGATGCCCGTGGGCACGGTAGAAGCGGCAAGTCGGACACTGAGGAAGCCTGGGAATCCAAA
CGGTTTGCGGAAGATTTTGAAGCTGTTTGCAGAGAATTCGAAGTAAGAGAAGCATATGTCTTGGGGTGGAGTATC
GGTGCCGCTGTGCTCGCTGATATCATGGCTTACACCACTCCAGTTAATATACTTGGCTTCATTAATGTTGCAGGA
CTTGTATACGTGGACCCATCGGTCAATTCACACGTAGCTAGTCGATTGGCACGAGAATGGGGGCCCCCATTCTTA
TTCCCTCCTTCCGGAGATGCCTTCCAAGAATCTTGTTCTCAATTTATTCATATATGCTCCGACGAAATTTCTCCC
GAGCTCTTCAGCATTTTAATGGAAGGAATGGCTATGCAGCCGCGCGGAATAGCAGCGCGGGTTTGTGTAAGAAAA
CAGAATCCCGAGAATATGTTGGAGGAGGCGCGAGGCGGGAGACTTCCACTCCTGGCCATCAGCGGCTTAAAAGAT
AAAGCATTGTATACTGAGAAGTTGAAGGGAGAGTTGGAAGCCTTGGGGTGGAAAAGGATGACGTATCGGTATTTA
CAAGACGCGGATCATATTCCGTGGGTGTCTTGTGCAGAAGAGTTCAGAGAAATTGTATTGACGTGGATGAAGGAG
TTAACGCCATAA
Transcript >AgabiH97|023860
ATGCAAAAAAAATCTATAAATTGGCGTGAATACCTCTCGCTTTGTGAAATCAGCCGATGCACCCCAGTCCTCGTT
CTGGTCCATGGTGGTTTCATGTGCAAAGAAGCATTCAATCCTATCTTTGACGATCCCAAGTGGACCTCTAGCCTA
TTCCTAGTGCGATACGATGCCCGTGGGCACGGTAGAAGCGGCAAGTCGGACACTGAGGAAGCCTGGGAATCCAAA
CGGTTTGCGGAAGATTTTGAAGCTGTTTGCAGAGAATTCGAAGTAAGAGAAGCATATGTCTTGGGGTGGAGTATC
GGTGCCGCTGTGCTCGCTGATATCATGGCTTACACCACTCCAGTTAATATACTTGGCTTCATTAATGTTGCAGGA
CTTGTATACGTGGACCCATCGGTCAATTCACACGTAGCTAGTCGATTGGCACGAGAATGGGGGCCCCCATTCTTA
TTCCCTCCTTCCGGAGATGCCTTCCAAGAATCTTGTTCTCAATTTATTCATATATGCTCCGACGAAATTTCTCCC
GAGCTCTTCAGCATTTTAATGGAAGGAATGGCTATGCAGCCGCGCGGAATAGCAGCGCGGGTTTGTGTAAGAAAA
CAGAATCCCGAGAATATGTTGGAGGAGGCGCGAGGCGGGAGACTTCCACTCCTGGCCATCAGCGGCTTAAAAGAT
AAAGCATTGTATACTGAGAAGTTGAAGGGAGAGTTGGAAGCCTTGGGGTGGAAAAGGATGACGTATCGGTATTTA
CAAGACGCGGATCATATTCCGTGGGTGTCTTGTGCAGAAGAGTTCAGAGAAATTGTATTGACGTGGATGAAGGAG
TTAACGCCATAA
Gene >AgabiH97|023860
ATGCAAAAAAAATCGTAACTGGCTTATCTATCGCCATCCGAACCGCACGTCCCTTTTGCTTTGGGGGAGTATAAA
TTGGCGGTAAAATACCTTCAACAACCTACTTTCTCTCGGATACTCATGACCGGAGACTTGGAAGTGAATACCTCT
CGCTTTGTGAAATCAGCCGATGGTACGGAAATATATACGGACGCAACAGGAAGCCGCTCGCCAAGCACCCCAGTC
CTCGTTCTGGTCCATGGTGGTTTCATGTGCAAAGAAGCATTCAATCCTATCTTTGACGATCCCAAGTGGACCTCT
AGCCTATTCCTAGTAAGCCAAGTTGGCAGCATGGTGAACTTGACCGAAGCTTATGATACTGACAGGTGCGATACG
ATGCCCGTGGGCACGGTAGAAGCGGCAAGTCGGACACTGAGGAAGCCTGGGAATCCAAACGGTTTGCGGAAGATT
TTGAAGCTGTTTGCAGAGAATTCGAAGTAAGAGAAGCATATGTCTTGGGGTGGAGTATCGGTGGTGCGCCATTTT
CTTTGCTCGATACCAATAGACGTGGCTCTGACGACTTTTCAGCCGCTGTGCTCGCTGATATCATGGCTTACACCA
CTCCAGTTAATATACTTGGCTTCATTAATGTTGCAGGACTTGTATACGTGGACCCATCGGTCAATTCACACGTAG
CTAGTCGATTGGCACGAGAATGGGGGCCCCCATTCTTATTCCCTCCTTCCGGAGATGCCTTCCAAGAATCTTGTT
CTCAATTTATTCATATATGCTCCGACGAAATTTCTCCCGAGCTCTTCAGCATTTTAATGGAAGGAATGGCTATGC
AGCCGCGCGGAATAGCAGCGCGGGTTTGTGTAAGAAAACAGAATCCCGAGAATATGTTGGAGGAGGCGCGAGGCG
GGAGACTTCCACTCCTGGCCATCAGCGGCTTAAAAGATAAAGCATTGTATACTGAGAAGTTGAAGGGAGAGTTGG
AAGCCTTGGGGTGGAAAAGGATGACGTATCGGTATTTACAAGACGCGGATCATATTCCGTGGGTGTCTTGTGCAG
AAGAGTTCAGAGAAATTGTATTGACGTGGATGAAGGAGTTAACGCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail