Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023800
Gene name
Locationscaffold_11:598715..600858
Strand+
Gene length (bp)2143
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 2.0E-70 23 323
PF17851 GH43_C2 Beta xylosidase C-terminal Concanavalin A-like domain 8.6E-24 371 580

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7LXU0|GH43B_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02656 PE=1 SV=2 3 579 5.0E-77
sp|A7LXT8|GH43A_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02654 PE=1 SV=1 1 580 4.0E-67
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 24 451 2.0E-62
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 24 451 4.0E-58
sp|P45982|XYLB_BUTFI Xylosidase/arabinosidase OS=Butyrivibrio fibrisolvens GN=xylB PE=3 SV=1 21 579 5.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7LXU0|GH43B_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02656 PE=1 SV=2 3 579 5.0E-77
sp|A7LXT8|GH43A_BACO1 Non-reducing end alpha-L-arabinofuranosidase BoGH43A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02654 PE=1 SV=1 1 580 4.0E-67
sp|P94489|XYNB_BACSU Beta-xylosidase OS=Bacillus subtilis (strain 168) GN=xynB PE=1 SV=2 24 451 2.0E-62
sp|P07129|XYNB_BACPU Beta-xylosidase OS=Bacillus pumilus GN=xynB PE=1 SV=2 24 451 4.0E-58
sp|P45982|XYLB_BUTFI Xylosidase/arabinosidase OS=Butyrivibrio fibrisolvens GN=xylB PE=3 SV=1 21 579 5.0E-56
sp|A9ZND1|XLOA_VIBSX Xylan 1,3-beta-xylosidase OS=Vibrio sp. GN=xloA PE=1 SV=1 23 477 3.0E-55
sp|P77713|YAGH_ECOLI Putative beta-xylosidase OS=Escherichia coli (strain K12) GN=yagH PE=3 SV=1 24 562 1.0E-51
sp|Q9WXE8|XYLO_PRERU Putative beta-xylosidase OS=Prevotella ruminicola PE=3 SV=2 33 325 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023800
MLLSLLSLALTIASVLGVTHLQQNPILPGWNPDPTILRVGEDYFIATSTFEYFPGHPIYHSKNLVDWTLVGHGLN
RPSQLALFGTPSDAGVWAPSLRYHDGTYYLTSTTRYVYTEELRLFPRSFYVTTKDIFSNNWSDPIYFDSLGYDGD
LFWDTNGDVYLTWSGINNNEDKIYSIYQSKIDLETGTSLTPAEIIFNGTLPHDSAARPEGPHIYHVNSTYYLLIA
EGGTGITHRSTIQRSTTSPAGPWENNPNNPILYNGANTSLSVQNTGHADIVQAIDGSWWGVALGVRPQGAEDDDL
RLSREQLGRETFLFPVKWVDGWPVFNNGRPLSEVVLLHEDADNDGKGGITSRETSIEETKIPDSESFYYNNFKSH
TLDNSFYFLRTPYAPFHTLLPSGSLEIKPNSYAIGDRDSPAMILRKQTSHQEVFETELEFSKPRTRLEEAGISIF
YGDSLHNEIGVSGGGPGEGRSVVVRTVTLNQQVGPWALTTANATVTNTTYISLSSTTEPVRLRIEASPMEYTLLY
AEGKQGDWNEVARFDGSVLSIPPAGGFFFKGAAFAIYNTGNGKPSLTKARFGYWKQGQFS*
Coding >AgabiH97|023800
ATGTTATTATCACTTCTCTCCCTGGCTCTGACTATCGCGTCTGTTTTGGGTGTGACACACCTTCAACAGAATCCA
ATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACGTTC
GAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCTCGTCGGGCATGGGTTGAAC
AGACCTTCCCAGTTGGCGCTGTTCGGAACGCCTTCGGACGCTGGTGTGTGGGCGCCATCATTGCGGTACCATGAT
GGAACATATTATTTGACGTCGACAACGCGATACGTGTACACCGAGGAACTGCGGCTCTTTCCAAGGTCCTTCTAT
GTCACGACGAAGGACATCTTCTCCAATAACTGGAGCGACCCTATTTATTTTGATAGTCTAGGCTATGATGGCGAC
TTATTCTGGGACACCAACGGAGATGTCTACCTTACTTGGTCAGGCATAAACAATAACGAGGACAAGATCTACAGT
ATATATCAGTCCAAGATTGACCTCGAAACTGGTACATCGCTAACACCCGCTGAAATCATCTTCAACGGCACTCTT
CCTCACGATTCCGCCGCACGACCCGAAGGTCCACACATCTACCACGTCAACTCAACATACTATCTTCTCATAGCC
GAAGGTGGTACGGGAATAACTCACCGGAGCACCATACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAAAAC
AATCCCAATAATCCTATACTTTACAATGGTGCAAATACCAGTTTATCAGTACAAAATACTGGCCATGCGGATATT
GTGCAGGCGATAGATGGAAGTTGGTGGGGAGTTGCTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGATTTG
AGATTGAGCAGGGAACAACTTGGAAGGGAAACTTTTCTGTTTCCTGTTAAATGGGTAGATGGATGGCCAGTTTTT
AATAATGGAAGGCCTTTGTCCGAAGTGGTTTTATTGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATTACA
TCAAGAGAAACTTCTATCGAAGAGACCAAGATACCTGATTCGGAATCATTCTACTACAACAACTTCAAATCCCAT
ACTCTCGACAATTCATTCTACTTCCTTCGTACTCCTTACGCTCCATTTCACACCCTCCTACCTTCCGGTTCTCTC
GAAATCAAACCAAACTCATACGCTATAGGAGATAGGGATTCTCCTGCTATGATCCTTCGTAAACAAACATCTCAC
CAAGAGGTTTTCGAAACGGAATTAGAGTTTTCTAAACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATTTTC
TATGGTGATTCTTTGCATAACGAAATTGGTGTTAGCGGAGGAGGTCCAGGAGAAGGAAGGTCTGTGGTAGTCAGG
ACGGTGACCTTGAATCAGCAAGTTGGACCTTGGGCATTAACGACGGCAAATGCTACCGTTACAAATACGACATAT
ATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCGAAGCTTCACCTATGGAATACACTCTACTCTAC
GCTGAAGGTAAACAAGGAGATTGGAATGAAGTAGCGAGATTCGATGGGTCTGTGTTGTCTATTCCACCCGCTGGT
GGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTTTGACGAAAGCGAGA
TTTGGGTATTGGAAGCAGGGACAATTTTCATGA
Transcript >AgabiH97|023800
ATGTTATTATCACTTCTCTCCCTGGCTCTGACTATCGCGTCTGTTTTGGGTGTGACACACCTTCAACAGAATCCA
ATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACGTTC
GAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCTCGTCGGGCATGGGTTGAAC
AGACCTTCCCAGTTGGCGCTGTTCGGAACGCCTTCGGACGCTGGTGTGTGGGCGCCATCATTGCGGTACCATGAT
GGAACATATTATTTGACGTCGACAACGCGATACGTGTACACCGAGGAACTGCGGCTCTTTCCAAGGTCCTTCTAT
GTCACGACGAAGGACATCTTCTCCAATAACTGGAGCGACCCTATTTATTTTGATAGTCTAGGCTATGATGGCGAC
TTATTCTGGGACACCAACGGAGATGTCTACCTTACTTGGTCAGGCATAAACAATAACGAGGACAAGATCTACAGT
ATATATCAGTCCAAGATTGACCTCGAAACTGGTACATCGCTAACACCCGCTGAAATCATCTTCAACGGCACTCTT
CCTCACGATTCCGCCGCACGACCCGAAGGTCCACACATCTACCACGTCAACTCAACATACTATCTTCTCATAGCC
GAAGGTGGTACGGGAATAACTCACCGGAGCACCATACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAAAAC
AATCCCAATAATCCTATACTTTACAATGGTGCAAATACCAGTTTATCAGTACAAAATACTGGCCATGCGGATATT
GTGCAGGCGATAGATGGAAGTTGGTGGGGAGTTGCTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGATTTG
AGATTGAGCAGGGAACAACTTGGAAGGGAAACTTTTCTGTTTCCTGTTAAATGGGTAGATGGATGGCCAGTTTTT
AATAATGGAAGGCCTTTGTCCGAAGTGGTTTTATTGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATTACA
TCAAGAGAAACTTCTATCGAAGAGACCAAGATACCTGATTCGGAATCATTCTACTACAACAACTTCAAATCCCAT
ACTCTCGACAATTCATTCTACTTCCTTCGTACTCCTTACGCTCCATTTCACACCCTCCTACCTTCCGGTTCTCTC
GAAATCAAACCAAACTCATACGCTATAGGAGATAGGGATTCTCCTGCTATGATCCTTCGTAAACAAACATCTCAC
CAAGAGGTTTTCGAAACGGAATTAGAGTTTTCTAAACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATTTTC
TATGGTGATTCTTTGCATAACGAAATTGGTGTTAGCGGAGGAGGTCCAGGAGAAGGAAGGTCTGTGGTAGTCAGG
ACGGTGACCTTGAATCAGCAAGTTGGACCTTGGGCATTAACGACGGCAAATGCTACCGTTACAAATACGACATAT
ATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCGAAGCTTCACCTATGGAATACACTCTACTCTAC
GCTGAAGGTAAACAAGGAGATTGGAATGAAGTAGCGAGATTCGATGGGTCTGTGTTGTCTATTCCACCCGCTGGT
GGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTTTGACGAAAGCGAGA
TTTGGGTATTGGAAGCAGGGACAATTTTCATGA
Gene >AgabiH97|023800
ATGTTATTATCACTTCTCTCCCTGGCTCTGACTATCGCGTCTGTTTTGGGTGTGACACACCTTCAACAGAATCCA
ATTCTGCCAGGCTGGAATCCAGATCCTACAATACTACGTGTTGGGGAGGACTACTTTATTGCTACTTCTACGTTC
GAGTATTTTCCTGGGCATCCGATATACCATAGCAAAAATTTGGTCGATTGGACCCTCGTCGGGCATGGGTTGAAC
AGACCTTCCCAGTTGGCGCTGTTCGGAACGCCTTCGGACGCTGGTGCGTATGATTAACTTGTACCCCCCCAGTAG
TGTCTGACTATCTATTGGCAGGTGTGTGGGCGCCATCATTGCGGTACCATGATGGAACATATTATTTGACGTCGA
CAACGCGATACGTGTACACCGGTGGGTGGACATGCACCTAACTTCTTATTTGTAGACCGCTTATAACTTCATAAG
AGGAACTGCGGCTCTTTCCAAGGTCCTTCTATGTCACGACGAAGGACATCTTCTCCAATAACTGGAGCGACCCTA
TTTATTTTGGTGAGCCCGAATTCTTTATCCTCCCTGTAAATATATCTCATGTCTTGCTGCAGATAGTCTAGGCTA
TGATGGCGACTTATTCTGGGACACCAACGGAGATGTACACATTCGTTCTCTATCACTCGAGTTACGTGCTCAAAA
TGCTATTTCAGGTCTACCTTACTTGGTCAGGCATAAACAATAACGAGGACAAGATCTACAGTACGTCTTCCTCCC
CTCATAATCCCTTTTGGTATTAAATGTGACTTCCTCCAGGTATATATCAGTCCAAGATTGACCTCGAAACTGGTA
CATCGCTAACACCCGCTGAAATCATCTTCAACGGCACTCTTCCTCACGATTCCGCCGCACGACCCGAAGGTCCAC
ACATCTACCACGTCAACTCAACATACTATCTTCTCATAGCCGAAGGTGGTACGGGAATAACTCACCGGAGCACCA
TACAAAGAAGTACGACCAGTCCTGCCGGACCTTGGGAAAACAATCCCAATAATCCTATACTTTACAATGGTGCAA
ATACCAGTTTATCAGTACAAAATACTGGCCATGCGGATATTGTGCAGGCGATAGATGGAAGTTGGTGGGGAGTTG
CTTTGGGAGTCCGACCACAGGGTGCGGAGGATGATGATTTGAGATTGAGCAGGGAACAACTTGGAAGGGAAACTT
TTCTGTTTCCTGTTAAATGGGTAGATGGATGGCCAGTTTTTAATAATGGAAGGCCTTTGTCCGAAGTGGTTTTAT
TGCATGAAGACGCTGATAACGATGGCAAGGGGGGCATTACATCAAGAGAAACTTCTATCGAAGAGACCAAGATAC
CTGATTCGGAATCATTCTACTACAACAACTTCAAATCCCATACTCTCGACAATTCATTCTACTTCCTTCGTACTC
CTTACGCTCCATTTCACACCCTCCTACCTTCCGGTTCTCTCGAAATCAAACCAAACTCATACGCTATAGGAGATA
GGGATTCTCCTGCTATGATCCTTCGTAAACAAACATCTCACCAAGAGGTTTTCGAAACGGAATTAGAGTTTTCTA
AACCAAGAACGAGACTCGAAGAAGCTGGGATCAGTATTTTCTATGGTGATTCTTTGCATAACGAAATTGGTGTTA
GCGGAGGAGGTCCAGGAGAAGGAAGGTCTGTGGTAGTCAGGACGGTGACCTTGAATCAGCAAGTTGGACCTTGGG
CATTAACGACGGCAAATGCTACCGTTACAAATGTAGGTACACTCCATCCTCGTGCATTTTTCAATTCTTCAAACT
GGCTCACCACATATCGTAGACGACATATATTTCTCTCTCAAGTACAACCGAGCCAGTACGACTTCGTATCGAAGC
TTCACCTATGGAATACACTCTACTCTACGCTGAAGGTAAACAAGGAGATTGGAATGAAGTAGCGAGATTCGATGG
GTCTGTGTTGTCTATTCCACCCGCTGGGTAAGTCGTTTTCACCAATATCAAGGAAGGCATTTATTTATTTACGCC
TTTCTATAGTGGTTTCTTCTTTAAAGGTGCCGCATTTGCGATTTACAATACGGGAAATGGAAAACCGAGTTTGAC
GAAAGCGAGATTTGGGTATTGGAAGCAGGGACAATTTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail