Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023720
Gene name
Locationscaffold_11:577435..578764
Strand-
Gene length (bp)1329
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20434 BD-FAE BD-FAE 2.5E-18 96 213
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.5E-10 113 235
PF00135 COesterase Carboxylesterase family 5.2E-08 91 217

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 90 238 2.0E-06
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 90 238 2.0E-06
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 90 238 2.0E-06
sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 98 247 3.0E-06
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 90 238 5.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023720
MFLFPFILVFTVVYSLFSTVTSTLRQHYFRLFQALSKYKEVMDAVSRLKDEGKIEIFDVLGPTVMAFNEAMNNDL
SAITGVQRSTFKYGTEERHQLDIYYPPTIQSSKTPVLFWIYGGGFVAGDRVLPLPSLSYPNVGAFFARQGAIMVV
PDYRLASPPMSAQYPKPVEDIRDAVQWITANRDKLMSQTTPNPDTDNIFMLGHSAGAVHLATLLLEPEVLAVHSP
LRSKIRGAVLLAGYYYYDPRSQLGEPFQLYYGDKQESHSALTLLRSAKSKGLNTLPNILFGESEWDPPIVEEIRK
KFRHELETFLQRPINHLIAKRHNHISIFAALSTGQGEEWALEVMDWIRSLA*
Coding >AgabiH97|023720
ATGTTTTTATTTCCTTTTATTCTCGTATTTACCGTTGTTTACTCTTTATTTTCAACGGTAACTTCAACGTTACGA
CAACACTACTTCCGACTCTTTCAGGCTTTGAGCAAGTACAAAGAAGTCATGGACGCCGTATCGAGGTTGAAAGAT
GAAGGGAAAATAGAGATTTTTGATGTTCTTGGTCCCACTGTTATGGCTTTTAATGAAGCCATGAACAATGATTTG
TCTGCTATTACTGGCGTGCAGAGGTCTACATTCAAGTACGGAACCGAAGAACGCCACCAACTCGATATATACTAT
CCTCCGACAATACAATCGTCGAAAACACCTGTCCTCTTCTGGATTTATGGAGGCGGTTTTGTAGCAGGAGATCGC
GTCCTTCCTCTTCCCTCACTGAGCTATCCTAATGTCGGCGCATTCTTTGCTCGGCAAGGCGCTATCATGGTTGTT
CCCGACTATCGCCTTGCGTCCCCTCCTATGTCTGCTCAATACCCTAAACCGGTTGAAGACATACGAGACGCCGTT
CAGTGGATAACCGCAAATCGAGATAAACTTATGAGTCAAACCACGCCGAACCCCGACACAGATAACATCTTCATG
CTTGGTCATTCAGCTGGAGCAGTTCACCTTGCCACGTTATTGCTGGAACCCGAAGTTCTTGCCGTGCATTCTCCT
CTCCGATCCAAAATTAGAGGTGCCGTTCTCCTGGCAGGGTATTATTACTATGATCCCCGTTCTCAGTTGGGCGAG
CCCTTCCAGCTGTATTATGGCGATAAGCAGGAATCTCATTCGGCCCTCACCTTGTTGAGATCAGCCAAAAGTAAA
GGACTCAATACGCTACCGAATATCTTGTTCGGTGAAAGCGAGTGGGATCCTCCGATTGTCGAGGAAATCAGGAAG
AAATTTCGGCATGAACTCGAGACTTTCCTTCAGCGACCCATCAACCATTTGATCGCCAAAAGGCATAATCATATC
AGTATATTCGCTGCTCTTTCGACTGGGCAAGGAGAGGAATGGGCTTTGGAGGTGATGGATTGGATACGGTCTCTT
GCATAA
Transcript >AgabiH97|023720
ATGTTTTTATTTCCTTTTATTCTCGTATTTACCGTTGTTTACTCTTTATTTTCAACGGTAACTTCAACGTTACGA
CAACACTACTTCCGACTCTTTCAGGCTTTGAGCAAGTACAAAGAAGTCATGGACGCCGTATCGAGGTTGAAAGAT
GAAGGGAAAATAGAGATTTTTGATGTTCTTGGTCCCACTGTTATGGCTTTTAATGAAGCCATGAACAATGATTTG
TCTGCTATTACTGGCGTGCAGAGGTCTACATTCAAGTACGGAACCGAAGAACGCCACCAACTCGATATATACTAT
CCTCCGACAATACAATCGTCGAAAACACCTGTCCTCTTCTGGATTTATGGAGGCGGTTTTGTAGCAGGAGATCGC
GTCCTTCCTCTTCCCTCACTGAGCTATCCTAATGTCGGCGCATTCTTTGCTCGGCAAGGCGCTATCATGGTTGTT
CCCGACTATCGCCTTGCGTCCCCTCCTATGTCTGCTCAATACCCTAAACCGGTTGAAGACATACGAGACGCCGTT
CAGTGGATAACCGCAAATCGAGATAAACTTATGAGTCAAACCACGCCGAACCCCGACACAGATAACATCTTCATG
CTTGGTCATTCAGCTGGAGCAGTTCACCTTGCCACGTTATTGCTGGAACCCGAAGTTCTTGCCGTGCATTCTCCT
CTCCGATCCAAAATTAGAGGTGCCGTTCTCCTGGCAGGGTATTATTACTATGATCCCCGTTCTCAGTTGGGCGAG
CCCTTCCAGCTGTATTATGGCGATAAGCAGGAATCTCATTCGGCCCTCACCTTGTTGAGATCAGCCAAAAGTAAA
GGACTCAATACGCTACCGAATATCTTGTTCGGTGAAAGCGAGTGGGATCCTCCGATTGTCGAGGAAATCAGGAAG
AAATTTCGGCATGAACTCGAGACTTTCCTTCAGCGACCCATCAACCATTTGATCGCCAAAAGGCATAATCATATC
AGTATATTCGCTGCTCTTTCGACTGGGCAAGGAGAGGAATGGGCTTTGGAGGTGATGGATTGGATACGGTCTCTT
GCATAA
Gene >AgabiH97|023720
ATGTTTTTATTTCCTTTTATTCTCGTATTTACCGTTGTTTACTCTTTGTCTGTACTCTCGTATATAAGTGACCTT
GTCGTAGATAGAACGAGGCGACAAGTGCCTCGAGTAGTTTGTCTAGTTCAATCTCTACTCGCTACTTAACTGAAG
ATTTTCAACGGTAACTTCAACGTTACGACAACACTACTTCCGACTCTTTCAGGCTTTGAGCAAGTACAAGTTAGT
ACATTTTCATTCCTCCGGCTTCATCACCCACTGAATCTAGCCCAACCACGCTCTGCAACCAAAGAGAAGTCATGG
ACGCCGTATCGAGGTTGAAAGATGAAGGGAAAATAGAGATTTTTGATGTTCTTGGTCCCAGTACGTTCTAGCTGC
TTGTTTAATGAACCACTGGACTCATTGAATCTCAGCTGTTATGGCTTTTAATGAAGCCATGAACAATGATTTGTC
TGCTATTACTGGCGTGCAGAGGTCTACATTCAAGTACGGAACCGAAGAACGCCACCAAGTACGTCACCCTCGAAA
GGCCTATCAATTTAATTCACAACTTTGATGCAGCTCGATATATACTATCCTCCGACAATACAATCGTCGAAAACA
CCTGTCCTCTTCTGGATTTATGGAGGCGGTTTTGTAGCAGGAGATCGCGTCCTTCCTCTTCCCTCACTGAGCTAT
CCTAATGTCGGCGCATTCTTTGCTCGGCAAGGCGCTATCATGGTTGTTCCCGACTATCGCCTTGCGTCCCCTCCT
ATGTCTGCTCAATACCCTAAACCGGTTGAAGACATACGAGACGCCGTTCAGTGGATAACCGCAAATCGAGATAAA
CTTATGAGTCAAACCACGCCGAACCCCGACACAGATAACATCTTCATGCTTGGTCATTCAGCTGGAGCAGTTCAC
CTTGCCACGTTATTGCTGGAACCCGAAGTTCTTGCCGTGCATTCTCCTCTCCGATCCAAAATTAGAGGTGCCGTT
CTCCTGGCAGGGTATTATTACTATGATCCCCGTTCTCAGTTGGGCGAGCCCTTCCAGCTGTATTATGGCGATAAG
CAGGAATCTCATTCGGCCCTCACCTTGTTGAGATCAGCCAAAAGTAAAGGACTCAATACGCTACCGAATATCTTG
TTCGGTGAAAGCGAGTGGGATCCTCCGATTGTCGAGGAAATCAGGAAGAAATTTCGGCATGAACTCGAGACTTTC
CTTCAGCGACCCATCAACCATTTGATCGCCAAAAGGCATAATCATATCAGTATATTCGCTGCTCTTTCGACTGGG
CAAGGAGAGGAATGGGCTTTGGAGGTGATGGATTGGATACGGTCTCTTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail