Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023630
Gene name
Locationscaffold_11:561848..562693
Strand-
Gene length (bp)845
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-11 71 203
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-06 78 184
PF13649 Methyltransf_25 Methyltransferase domain 3.4E-06 77 181

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9DD20|MET7B_MOUSE Methyltransferase-like protein 7B OS=Mus musculus GN=Mettl7b PE=1 SV=2 76 220 2.0E-13
sp|Q562C4|MET7B_RAT Methyltransferase-like protein 7B OS=Rattus norvegicus GN=Mettl7b PE=1 SV=1 76 220 5.0E-13
sp|Q6UX53|MET7B_HUMAN Methyltransferase-like protein 7B OS=Homo sapiens GN=METTL7B PE=1 SV=2 39 218 8.0E-11
sp|Q9H8H3|MET7A_HUMAN Methyltransferase-like protein 7A OS=Homo sapiens GN=METTL7A PE=1 SV=1 46 220 2.0E-08

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023630
MKLSTAFGIFPDLWWGLRIAFWPTCFAIWQSPGLLLQPQRLSQTFFTPIWDVLGAVADQACRPVKEKLITPYAYG
TVLDLGAGFGHTMKYLDRQKITKYVALEPNIKMHDRIRAIGAQEGYKESDGSLLILPYGVQDSSAILSALDNTPF
DTIISILTLCSIPSPQQSITNLIRDTLKPGGLFLYYEHVLSPKQDVAFWQRLWTPLWAFMFDGCRLDRPSHLYID
EIGNDAGESIWKESNVWGKEGEPEEHLHWHRIGRYIKA*
Coding >AgabiH97|023630
ATGAAACTCTCAACCGCCTTTGGTATCTTTCCCGACCTCTGGTGGGGTCTCCGCATCGCCTTCTGGCCTACTTGC
TTCGCCATATGGCAATCTCCCGGTCTTCTCCTCCAACCTCAAAGACTCTCGCAGACATTTTTCACTCCCATCTGG
GATGTCCTAGGCGCAGTCGCAGATCAAGCTTGTAGACCTGTCAAAGAAAAACTCATCACTCCCTATGCATACGGC
ACAGTTCTTGACCTCGGCGCTGGCTTCGGACATACGATGAAGTATCTTGACCGTCAAAAGATAACCAAATACGTC
GCTCTAGAACCTAATATCAAAATGCACGACCGGATTCGCGCCATCGGTGCACAAGAAGGATACAAAGAATCCGAT
GGCTCACTTCTCATCCTTCCATACGGCGTCCAAGATTCATCCGCCATCCTCTCCGCTCTCGATAACACCCCATTC
GACACTATAATATCCATCCTAACCCTCTGTTCCATACCCTCACCTCAACAATCGATAACAAACCTCATACGTGAT
ACCCTTAAACCAGGGGGTTTGTTCTTGTATTACGAACATGTCCTCAGTCCGAAGCAGGATGTTGCGTTTTGGCAA
AGACTGTGGACACCGCTTTGGGCTTTTATGTTTGATGGGTGTAGACTTGACCGACCAAGTCATTTGTATATAGAT
GAAATTGGGAATGATGCTGGGGAAAGTATTTGGAAGGAAAGCAACGTTTGGGGGAAGGAAGGCGAGCCAGAAGAA
CATCTCCATTGGCACCGTATTGGTCGTTATATCAAAGCTTGA
Transcript >AgabiH97|023630
ATGAAACTCTCAACCGCCTTTGGTATCTTTCCCGACCTCTGGTGGGGTCTCCGCATCGCCTTCTGGCCTACTTGC
TTCGCCATATGGCAATCTCCCGGTCTTCTCCTCCAACCTCAAAGACTCTCGCAGACATTTTTCACTCCCATCTGG
GATGTCCTAGGCGCAGTCGCAGATCAAGCTTGTAGACCTGTCAAAGAAAAACTCATCACTCCCTATGCATACGGC
ACAGTTCTTGACCTCGGCGCTGGCTTCGGACATACGATGAAGTATCTTGACCGTCAAAAGATAACCAAATACGTC
GCTCTAGAACCTAATATCAAAATGCACGACCGGATTCGCGCCATCGGTGCACAAGAAGGATACAAAGAATCCGAT
GGCTCACTTCTCATCCTTCCATACGGCGTCCAAGATTCATCCGCCATCCTCTCCGCTCTCGATAACACCCCATTC
GACACTATAATATCCATCCTAACCCTCTGTTCCATACCCTCACCTCAACAATCGATAACAAACCTCATACGTGAT
ACCCTTAAACCAGGGGGTTTGTTCTTGTATTACGAACATGTCCTCAGTCCGAAGCAGGATGTTGCGTTTTGGCAA
AGACTGTGGACACCGCTTTGGGCTTTTATGTTTGATGGGTGTAGACTTGACCGACCAAGTCATTTGTATATAGAT
GAAATTGGGAATGATGCTGGGGAAAGTATTTGGAAGGAAAGCAACGTTTGGGGGAAGGAAGGCGAGCCAGAAGAA
CATCTCCATTGGCACCGTATTGGTCGTTATATCAAAGCTTGA
Gene >AgabiH97|023630
ATGAAACTCTCAACCGCCTTTGGTATCTTTCCCGACCTCTGGTGGGGTCTCCGCATCGCCTTCTGGCCTACTTGC
TTCGCCATATGGCAATCTCCCGGTCTTCTCCTCCAACCTCAAAGACTCTCGCAGACATTTTTCACTCCCATCTGG
GATGTCCTAGGCGCAGTCGCAGATCAAGCTTGTAGACCTGTCAAAGAAAAACTCATCACTCCCTATGCATACGGC
ACAGTTCTTGACCTCGGCGCTGGTAAGTACTATACATGTTTTTTTCGCACTTGAGGGTGATTTGTCTATTTTAAG
GCTTCGGACATACGATGAAGTATCTTGACCGTCAAAAGATAACCAAATACGTCGCTCTAGAACCTAATATCAAAA
TGCACGACCGGATTCGCGCCATCGGTGCACAAGAAGGATACAAAGAATCCGATGGCTCACTTCTCATCCTTCCAT
ACGGCGTCCAAGATTCATCCGCCATCCTCTCCGCTCTCGATAACACCCCATTCGACACTATAATATCCATCCTAA
CCCTCTGTTCCATACCCTCACCTCAACAATCGATAACAAACCTCATACGTGATACCCTTAAACCAGGGGGTTTGT
TCTTGTATTACGAACATGTCCTCAGTCCGAAGCAGGATGTTGCGTTTTGGCAAAGACTGTGGACACCGCTTTGGG
CTTTTATGTTTGATGGGTGTAGACTTGACCGACCAAGTCATTTGTATATAGATGAAATTGGGAATGATGCTGGGG
AAAGTATTTGGAAGGAAAGCAACGTTTGGGGGAAGGAAGGCGAGCCAGAAGAACATCTCCATTGGCACCGTATTG
GTCGTTATATCAAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail