Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023550
Gene name
Locationscaffold_11:544788..545367
Strand-
Gene length (bp)579
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 15 90 1.0E-07
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 6 90 5.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6389 0.5885 0.1793 0.195 0.2972 0.0047 0.1602 0.1284 0.1159 0.0235

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup173
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|024140
Agaricus bisporus var bisporus H39 AgabiH39|306500
Agaricus bisporus var bisporus H39 AgabiH39|306300
Agaricus bisporus var bisporus H39 AgabiH39|306000
Agaricus bisporus var bisporus H39 AgabiH39|305800
Agaricus bisporus var bisporus H39 AgabiH39|305600
Agaricus bisporus var bisporus H39 AgabiH39|305100
Agaricus bisporus var bisporus H39 AgabiH39|304500
Agaricus bisporus var bisporus H39 AgabiH39|301800
Agaricus bisporus var bisporus H39 AgabiH39|234900
Agaricus bisporus var bisporus H39 AgabiH39|305300
Agaricus bisporus var bisporus H39 AgabiH39|107580
Agaricus bisporus var bisporus H39 AgabiH39|117180
Agaricus bisporus var bisporus H39 AgabiH39|029320
Agaricus bisporus var bisporus H39 AgabiH39|029390
Agaricus bisporus var bisporus H39 AgabiH39|065210
Agaricus bisporus var bisporus H39 AgabiH39|027140
Agaricus bisporus var bisporus H39 AgabiH39|080500
Agaricus bisporus var bisporus H39 AgabiH39|099320
Agaricus bisporus var bisporus H39 AgabiH39|107550
Agaricus bisporus var bisporus H39 AgabiH39|065350
Agaricus bisporus var bisporus H97 AgabiH97|065140
Agaricus bisporus var bisporus H97 AgabiH97|107550
Agaricus bisporus var bisporus H97 AgabiH97|099320
Agaricus bisporus var bisporus H97 AgabiH97|080500
Agaricus bisporus var bisporus H97 AgabiH97|065350
Agaricus bisporus var bisporus H97 AgabiH97|065250
Agaricus bisporus var bisporus H97 AgabiH97|065210
Agaricus bisporus var bisporus H97 AgabiH97|065200
Agaricus bisporus var bisporus H97 AgabiH97|065170
Agaricus bisporus var bisporus H97 AgabiH97|065120
Agaricus bisporus var bisporus H97 AgabiH97|014580
Agaricus bisporus var bisporus H97 AgabiH97|065040
Agaricus bisporus var bisporus H97 AgabiH97|064700
Agaricus bisporus var bisporus H97 AgabiH97|064190
Agaricus bisporus var bisporus H97 AgabiH97|029390
Agaricus bisporus var bisporus H97 AgabiH97|029320
Agaricus bisporus var bisporus H97 AgabiH97|027140
Agaricus bisporus var bisporus H97 AgabiH97|024140
Agaricus bisporus var bisporus H97 AgabiH97|023550 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|107580
Agaricus bisporus var bisporus H97 AgabiH97|065070
Agaricus bisporus var bisporus H97 AgabiH97|117180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023550
MSGFGEYTIPRGTLECGGIKLVNDADHPLIPPKDGDIHGFFLAWNTLINHSLRTIFPHHPCRYEGFNMNMAKFTC
YAAFVVNGNQVTDLLHDLRI*
Coding >AgabiH97|023550
ATGAGTGGCTTCGGCGAATATACAATCCCCCGTGGCACCCTCGAATGCGGTGGTATCAAGCTGGTCAACGATGCC
GACCATCCTCTCATACCTCCAAAGGACGGGGACATCCATGGATTTTTCCTGGCATGGAACACTCTCATCAACCAT
AGTCTACGTACCATTTTTCCACACCATCCATGCCGCTATGAAGGTTTCAACATGAACATGGCCAAGTTCACCTGC
TACGCCGCCTTCGTTGTCAACGGAAACCAGGTCACTGACTTGCTCCATGACTTGAGGATATGA
Transcript >AgabiH97|023550
ATGAGTGGCTTCGGCGAATATACAATCCCCCGTGGCACCCTCGAATGCGGTGGTATCAAGCTGGTCAACGATGCC
GACCATCCTCTCATACCTCCAAAGGACGGGGACATCCATGGATTTTTCCTGGCATGGAACACTCTCATCAACCAT
AGTCTACGTACCATTTTTCCACACCATCCATGCCGCTATGAAGGTTTCAACATGAACATGGCCAAGTTCACCTGC
TACGCCGCCTTCGTTGTCAACGGAAACCAGGTCACTGACTTGCTCCATGACTTGAGGATATGA
Gene >AgabiH97|023550
ATGAGTGGCTTCGGCGAATATACAATCCCCCGTGGCACCCTCGAATGCGGTGGTATCAAGCTGGTCAACGATGCC
GACCATCCTCTCATACCTCCAAAGGACGGGGACATCCATGGATTTTTCCTGGCATGGAACACTCTCATCAACCAT
AGTCTACGTACCATTTTTCCAGTTTTTTTCTCCCGAAACATCTGACCGTTATTCACAGTACTTCAACCGCACCTG
TATCGAGTCACCTTCTAGCACCATCCATGCCGCTATGAAGGTATGTGCTTTCATTCTTTCCTTCTTGTTCGTTCA
CTGACTTTGGGCAGGTTTCAACATGAACATGGCCAAGTTCACCTGCTACGCCGCCTTCGTTGTCAACGGAAACCA
GGTCACTGACTTGGTCAGTGTCGGAGAGATGTCCCCAAAGACTGGATCCAACCAGCTAGTCAACCTGTTGCTATT
GGCGGCTTGAACGCGCACGACGTGTTCAAGGGTGACAGCTCCATGACTTGAGGTGAGTTTCGCGCATCGCCATAG
TTATCCTAACCGATGCTTACTCTCTAGCTGGTCTCTACCCCTCATAGGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail