Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023440
Gene name
Locationscaffold_11:525086..527537
Strand-
Gene length (bp)2451
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02992 Transposase_21 Transposase family tnp2 1.2E-25 378 517

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023440
MSLESAEHPGKVKCTCGCNKFVVYATKRAHLNGKSTTRIGASVLEEFRDLRPSQTTSQKRNLSASPSHDQARPTT
RRRLAVSGADQPGDVDLVFPPDEPEHRADSPPHRSTYALDTIRNAFEERWRNEQQHDFNDEESKKSSETGGEDDD
ELDSGGDGENIGGNMSDEVGDGDGDDSTEVDGTAEDDDGSLPGQDVPEIAFWDEIDEDYCRRVMSSDYSLGEADL
SLLHQYTLKVEEHLTEKTFKRLKRTFPHAHHDTLKVTKKRVKQLSGFESIRYSCCVNSCVCFTGPYQDSTRCPHC
NEARFDSQDKPRKFFEYIPLIPRLQAMSANRRHAEMMRYRTNFEHIPNTITDIFDGSHYRSLLNTIVPSSRDTNP
CFYFSDPRNVALGLSTDGFAPFKRREKTCWPIILFNYNLPPKIRFQKKYCINVGTVPGPKKPWDMDSFLWPLVRE
LVQLEAGVKAFDGVTQSLFLLHAFLMIGFGDIPAMSLIMCMKGCNGICPCRICSIKGVSFGSKTYYVPLRWDKIP
HSEPPQYDLAALPIRVHDELLAQAMEVQMAPNKATSERLSKQYGIKGTPILSTLSSISFPASFPFDFMHLIWENL
IPNLILFWTGNFKDLDHQDADYVIQPSIWNDIGKITASCKASIPSAFGAPVPNIAIHRSQMTSEMYSNWTLFIAP
IVLWGRFKRSVYYKHFMKLVKLLNLCLELEIGEEALDEIDGGFQSWVEDYEHLYYQNKPERLSACPLTIHALLHI
AWGIKTAGPVWTYWAFPMERHCNSLLPSIKSR*
Coding >AgabiH97|023440
ATGAGCTTGGAAAGTGCCGAACATCCAGGCAAAGTCAAATGCACCTGTGGTTGTAACAAATTTGTCGTCTATGCC
ACGAAACGGGCGCATTTGAACGGCAAATCTACAACTCGTATTGGTGCCAGTGTTCTCGAGGAATTTCGAGACCTC
CGACCGTCACAGACTACCTCGCAGAAACGCAACCTTTCCGCTTCACCCTCGCACGACCAGGCGAGGCCAACAACG
AGGCGAAGACTTGCTGTATCTGGAGCTGATCAACCGGGCGATGTTGATCTGGTGTTTCCACCAGATGAACCTGAG
CATCGAGCCGATTCTCCTCCCCATCGGTCAACCTATGCACTTGATACAATTAGAAATGCGTTTGAAGAACGTTGG
AGAAATGAGCAGCAGCATGATTTCAACGATGAAGAGAGCAAAAAGAGCAGTGAGACCGGTGGAGAGGATGACGAT
GAGCTTGACAGCGGTGGTGATGGTGAAAATATCGGCGGAAATATGAGTGATGAGGTTGGAGATGGAGATGGTGAT
GATAGTACTGAGGTTGATGGCACTGCCGAGGACGATGATGGATCATTGCCGGGTCAGGATGTCCCTGAAATTGCC
TTTTGGGATGAGATTGATGAAGATTACTGCAGGAGAGTAATGTCATCGGATTATTCATTAGGCGAGGCGGACCTC
AGTCTCCTCCACCAATATACCCTCAAGGTCGAGGAGCACCTCACCGAGAAGACCTTCAAACGCCTCAAACGTACT
TTTCCCCATGCGCATCATGATACTCTCAAAGTTACAAAGAAACGTGTGAAGCAGCTTTCCGGATTTGAATCAATA
CGTTATAGCTGTTGTGTCAACAGTTGCGTCTGCTTTACTGGCCCATATCAAGATTCGACCCGCTGTCCCCATTGC
AATGAGGCTAGATTTGACAGTCAGGACAAACCGCGAAAATTTTTCGAGTATATTCCCCTAATCCCACGTCTACAA
GCCATGTCTGCCAATCGTCGGCATGCAGAAATGATGCGCTACCGTACGAATTTTGAACACATCCCTAATACCATC
ACCGATATCTTTGATGGTTCTCACTACAGATCGTTGTTGAATACTATAGTCCCCTCGTCCAGGGATACCAATCCT
TGTTTCTATTTCTCCGACCCCCGCAATGTCGCTCTCGGTCTTTCCACCGATGGTTTTGCACCATTCAAACGACGT
GAAAAGACGTGCTGGCCTATCATCCTCTTTAACTACAACCTGCCACCCAAAATTCGGTTTCAGAAGAAATATTGC
ATCAACGTTGGCACGGTGCCCGGCCCCAAGAAGCCATGGGATATGGATTCTTTCCTCTGGCCACTCGTTCGCGAG
CTGGTTCAACTTGAGGCTGGGGTCAAAGCCTTTGATGGCGTCACTCAATCCCTCTTCCTACTCCATGCTTTTCTC
ATGATTGGATTCGGTGACATACCTGCAATGTCGCTCATAATGTGCATGAAGGGTTGCAATGGAATCTGTCCTTGT
AGAATATGCAGCATCAAAGGTGTTTCCTTTGGTTCGAAAACATATTACGTCCCGTTGCGATGGGATAAAATTCCG
CATTCCGAACCACCACAATACGATCTGGCTGCACTTCCTATACGGGTACATGATGAACTTTTAGCTCAAGCAATG
GAGGTTCAAATGGCTCCCAATAAAGCGACATCGGAGAGGCTTTCAAAACAATACGGCATCAAAGGCACACCAATC
CTCAGTACATTATCGTCTATCTCGTTTCCTGCGTCTTTTCCTTTTGATTTCATGCATCTTATTTGGGAGAACTTG
ATTCCTAATCTTATTCTGTTTTGGACCGGCAATTTCAAAGACCTCGACCACCAAGATGCAGACTACGTCATTCAG
CCCTCCATCTGGAACGACATCGGGAAAATCACCGCCTCTTGCAAAGCTTCTATTCCATCGGCGTTTGGTGCGCCT
GTACCCAATATTGCGATACATCGGTCCCAAATGACTTCAGAGATGTATTCTAATTGGACTCTCTTCATTGCGCCC
ATTGTCTTATGGGGCCGCTTCAAGCGATCAGTCTACTACAAACATTTCATGAAGCTCGTCAAATTACTCAATCTA
TGTTTGGAACTCGAGATTGGTGAAGAAGCACTAGATGAAATTGACGGTGGGTTTCAATCGTGGGTGGAAGATTAT
GAGCATTTGTATTACCAAAATAAACCGGAACGACTCTCCGCCTGTCCTTTGACCATCCATGCGCTGCTTCATATT
GCTTGGGGTATCAAAACGGCCGGTCCTGTCTGGACCTATTGGGCATTTCCGATGGAACGCCACTGCAACTCACTG
CTCCCTTCTATCAAAAGTCGATGA
Transcript >AgabiH97|023440
ATGAGCTTGGAAAGTGCCGAACATCCAGGCAAAGTCAAATGCACCTGTGGTTGTAACAAATTTGTCGTCTATGCC
ACGAAACGGGCGCATTTGAACGGCAAATCTACAACTCGTATTGGTGCCAGTGTTCTCGAGGAATTTCGAGACCTC
CGACCGTCACAGACTACCTCGCAGAAACGCAACCTTTCCGCTTCACCCTCGCACGACCAGGCGAGGCCAACAACG
AGGCGAAGACTTGCTGTATCTGGAGCTGATCAACCGGGCGATGTTGATCTGGTGTTTCCACCAGATGAACCTGAG
CATCGAGCCGATTCTCCTCCCCATCGGTCAACCTATGCACTTGATACAATTAGAAATGCGTTTGAAGAACGTTGG
AGAAATGAGCAGCAGCATGATTTCAACGATGAAGAGAGCAAAAAGAGCAGTGAGACCGGTGGAGAGGATGACGAT
GAGCTTGACAGCGGTGGTGATGGTGAAAATATCGGCGGAAATATGAGTGATGAGGTTGGAGATGGAGATGGTGAT
GATAGTACTGAGGTTGATGGCACTGCCGAGGACGATGATGGATCATTGCCGGGTCAGGATGTCCCTGAAATTGCC
TTTTGGGATGAGATTGATGAAGATTACTGCAGGAGAGTAATGTCATCGGATTATTCATTAGGCGAGGCGGACCTC
AGTCTCCTCCACCAATATACCCTCAAGGTCGAGGAGCACCTCACCGAGAAGACCTTCAAACGCCTCAAACGTACT
TTTCCCCATGCGCATCATGATACTCTCAAAGTTACAAAGAAACGTGTGAAGCAGCTTTCCGGATTTGAATCAATA
CGTTATAGCTGTTGTGTCAACAGTTGCGTCTGCTTTACTGGCCCATATCAAGATTCGACCCGCTGTCCCCATTGC
AATGAGGCTAGATTTGACAGTCAGGACAAACCGCGAAAATTTTTCGAGTATATTCCCCTAATCCCACGTCTACAA
GCCATGTCTGCCAATCGTCGGCATGCAGAAATGATGCGCTACCGTACGAATTTTGAACACATCCCTAATACCATC
ACCGATATCTTTGATGGTTCTCACTACAGATCGTTGTTGAATACTATAGTCCCCTCGTCCAGGGATACCAATCCT
TGTTTCTATTTCTCCGACCCCCGCAATGTCGCTCTCGGTCTTTCCACCGATGGTTTTGCACCATTCAAACGACGT
GAAAAGACGTGCTGGCCTATCATCCTCTTTAACTACAACCTGCCACCCAAAATTCGGTTTCAGAAGAAATATTGC
ATCAACGTTGGCACGGTGCCCGGCCCCAAGAAGCCATGGGATATGGATTCTTTCCTCTGGCCACTCGTTCGCGAG
CTGGTTCAACTTGAGGCTGGGGTCAAAGCCTTTGATGGCGTCACTCAATCCCTCTTCCTACTCCATGCTTTTCTC
ATGATTGGATTCGGTGACATACCTGCAATGTCGCTCATAATGTGCATGAAGGGTTGCAATGGAATCTGTCCTTGT
AGAATATGCAGCATCAAAGGTGTTTCCTTTGGTTCGAAAACATATTACGTCCCGTTGCGATGGGATAAAATTCCG
CATTCCGAACCACCACAATACGATCTGGCTGCACTTCCTATACGGGTACATGATGAACTTTTAGCTCAAGCAATG
GAGGTTCAAATGGCTCCCAATAAAGCGACATCGGAGAGGCTTTCAAAACAATACGGCATCAAAGGCACACCAATC
CTCAGTACATTATCGTCTATCTCGTTTCCTGCGTCTTTTCCTTTTGATTTCATGCATCTTATTTGGGAGAACTTG
ATTCCTAATCTTATTCTGTTTTGGACCGGCAATTTCAAAGACCTCGACCACCAAGATGCAGACTACGTCATTCAG
CCCTCCATCTGGAACGACATCGGGAAAATCACCGCCTCTTGCAAAGCTTCTATTCCATCGGCGTTTGGTGCGCCT
GTACCCAATATTGCGATACATCGGTCCCAAATGACTTCAGAGATGTATTCTAATTGGACTCTCTTCATTGCGCCC
ATTGTCTTATGGGGCCGCTTCAAGCGATCAGTCTACTACAAACATTTCATGAAGCTCGTCAAATTACTCAATCTA
TGTTTGGAACTCGAGATTGGTGAAGAAGCACTAGATGAAATTGACGGTGGGTTTCAATCGTGGGTGGAAGATTAT
GAGCATTTGTATTACCAAAATAAACCGGAACGACTCTCCGCCTGTCCTTTGACCATCCATGCGCTGCTTCATATT
GCTTGGGGTATCAAAACGGCCGGTCCTGTCTGGACCTATTGGGCATTTCCGATGGAACGCCACTGCAACTCACTG
CTCCCTTCTATCAAAAGTCGATGA
Gene >AgabiH97|023440
ATGAGCTTGGAAAGTGCCGAACATCCAGGCAAAGTCAAATGCACCTGTGGTTGTAACAAATTTGTCGTCTATGCC
ACGAAACGGGCGCATTTGAACGGCAAATCTACAACTCGTATTGGTGCCAGTGTTCTCGAGGAATTTCGAGACCTC
CGACCGTCACAGACTACCTCGCAGAAACGCAACCTTTCCGCTTCACCCTCGCACGACCAGGCGAGGCCAACAACG
AGGCGAAGACTTGCTGTATCTGGAGCTGATCAACCGGGCGATGTTGATCTGGTGTTTCCACCAGATGAACCTGAG
CATCGAGCCGATTCTCCTCCCCATCGGTCAACCTATGCACTTGATACAATTAGAAATGCGTTTGAAGAACGTTGG
AGAAATGAGCAGCAGCATGATTTCAACGATGAAGAGAGCAAAAAGAGCAGTGAGACCGGTGGAGAGGATGACGAT
GAGCTTGACAGCGGTGGTGATGGTGAAAATATCGGCGGAAATATGAGTGATGAGGTTGGAGATGGAGATGGTGAT
GATAGTACTGAGGTTGATGGCACTGCCGAGGACGATGATGGATCATTGCCGGGTCAGGATGTCCCTGAAATTGCC
TTTTGGGATGAGATTGATGAAGATTACTGCAGGAGAGTAATGTCATCGGGTTCGTACATCCGTACTACTTCCTTT
CGATCAACTAATTATAAATCACTTTAGATTATTCATTAGGCGAGGCGGACCTCAGTCTCCTCCACCAATATACCC
TCAAGGTCGAGGAGCACCTCACCGAGAAGACCTTCAAACGCCTCAAACGTACTTTTCCCCATGCGCATCATGATA
CTCTCAAAGTTACAAAGAAACGTGTGAAGCAGCTTTCCGGATTTGAATCAATACGTTATAGCTGTTGTGTCAACA
GTTGCGTCTGCTTTACTGGCCCATATCAAGATTCGACCCGCTGTCCCCATTGCAATGAGGCTAGATTTGACAGTC
AGGACAAACCGCGAAAATTTTTCGAGTATATTCCCCTAATCCCACGTCTACAAGCCATGTCTGCCAATCGTCGGC
ATGCAGAAATGATGCGCTACCGTACGAATTTTGAACACATCCCTAATACCATCACCGATATCTTTGATGGTTCTC
ACTACAGATCGTTGTTGAATACTATAGTCCCCTCGTCCAGGGATACCAATCCTTGTTTCTATTTCTCCGACCCCC
GCAATGTCGCTCTCGGTCTTTCCACCGATGGTTTTGCACCATTCAAACGACGTGAAAAGACGTGCTGGCCTATCA
TCCTCTTTAACTACAACCTGCCACCCAAAATTCGGTTTCAGAAGAAATATTGCATCAACGTTGGCACGGTGCCCG
GCCCCAAGAAGCCATGGGATATGGATTCTTTCCTCTGGCCACTCGTTCGCGAGCTGGTTCAACTTGAGGCTGGGG
TCAAAGCCTTTGATGGCGTCACTCAATCCCTCTTCCTACTCCATGCTTTTCTCATGATTGGATTCGGTGACATAC
CTGCAATGTCGCTCATAATGTGCATGAAGGGTTGCAATGGAATCTGTCCTTGTAGAATATGCAGCATCAAAGGTG
TTTCCTTTGGTTCGAAAACATATTACGTCCCGTTGCGATGGGATAAAATTCCGCATTCCGAACCACCACAATACG
ATCTGGCTGCACTTCCTATACGGGTACATGATGAACTTTTAGCTCAAGCAATGGAGGTTCAAATGGCTCCCAATA
AAGCGACATCGGAGAGGCTTTCAAAACAATACGGCATCAAAGGCACACCAATCCTCAGTACATTATCGTCTATCT
CGTTTCCTGCGTCTTTTCCTTTTGATTTCATGCATCTTATTTGGGAGAACTTGATTCCTAATCTTATTCTGTTTT
GGACCGGCAATTTCAAAGACCTCGACCACCAAGATGCAGACTACGTCATTCAGCCCTCCATCTGGAACGACATCG
GGAAAATCACCGCCTCTTGCAAAGCTTCTATTCCATCGGCGTTTGGTGCGCCTGTACCCAATATTGCGATACATC
GGTCCCAAATGACTTCAGAGATGTATTCTAATTGGACTCTCTTCATTGCGCCCATTGTCTTATGGGGCCGCTTCA
AGCGATCAGTCTACTACAAACATTTCATGAAGCTCGTCAAATTACTCAATCTATGTTTGGAACTCGAGATTGGTG
AAGAAGCACTAGATGAAATTGACGGTGGGTTTCAATCGTGGGTGGAAGATTATGAGCAGTGAGTATCCCGTCACT
TTGGTTCTTGACAAAGGCTGAATTTCCAACAGTTTGTATTACCAAAATAAACCGGAACGACTCTCCGCCTGTCCT
TTGACCATCCATGCGCTGCTTCATATTGCTTGGGGTATCAAAACGGCCGGTCCTGTCTGGACCTATTGGGCATTT
CCGATGGAACGCCACTGCAACTCACTGCTCCCTTCTATCAAAAGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail