Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|023370
Gene name
Locationscaffold_11:507213..508770
Strand+
Gene length (bp)1557
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01454 MAGE MAGE homology domain 7.3E-46 74 381

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|023370
MAPTRRQASQSQRPANGRSQRDGPARSQATRRARVESDDEVDENEMDVDAEHSEAENAEGEGGAADIRLKAADLV
RLALFHEARRMPLRREDINKKVLPNSTRIFKAVFDRAQSILHETFGLQLQELPSKAGLDQEAAAASAEKKGKKST
SGTQDPQGEDELEEARKATMGKRRATAVGSKTYILRSILDARLIEIANKTDASIVEEEALLNFATGDLFGGDGNS
GAGAAIFLDDDDEWDDGAELHPRTYGSIFSWGQNDQLGALGVLYVILALILVNGKVVQERALRGQLKELGLPSTA
GRSPILFTTIATHRAMKVDDYLSLLLRQGYLDRQIVGEVSGAGRKRARGKVGGDAHNDMGMQAGDMYEWRWGARA
FCEVGETDIAKFVAEFMVNYNTGGKAGDEEEDDEGTEGRKKTKVEKMYMGVRKAAGGSLAAIRDWNN*
Coding >AgabiH97|023370
ATGGCTCCAACACGCAGACAAGCCTCGCAGTCCCAAAGACCAGCAAATGGACGATCGCAGCGTGATGGGCCAGCA
CGTTCGCAGGCGACCCGACGAGCACGGGTAGAGTCGGATGATGAAGTCGACGAAAATGAGATGGATGTCGACGCA
GAACATTCAGAAGCTGAGAATGCAGAAGGTGAAGGTGGGGCAGCTGATATCCGACTAAAGGCTGCGGATCTGGTT
CGACTAGCCCTATTTCACGAAGCACGGCGGATGCCATTGAGACGCGAAGATATCAATAAAAAAGTCCTACCAAAT
TCGACGAGGATTTTCAAAGCAGTCTTTGATCGGGCTCAGTCGATACTCCATGAGACGTTCGGTCTTCAACTCCAG
GAGCTACCATCGAAAGCTGGTTTGGATCAGGAAGCTGCAGCAGCGTCGGCAGAAAAAAAAGGAAAGAAGTCAACT
TCAGGTACGCAGGATCCCCAGGGTGAAGACGAGCTGGAAGAAGCTAGAAAGGCTACTATGGGAAAGAGACGAGCT
ACTGCTGTCGGATCAAAGACATACATTTTACGTTCCATCCTGGACGCTAGACTCATTGAGATAGCTAACAAAACG
GATGCTAGTATCGTGGAAGAGGAAGCTCTCCTTAACTTTGCTACTGGTGATCTCTTTGGTGGCGATGGCAACTCT
GGAGCTGGCGCTGCTATATTTTTGGATGATGACGATGAATGGGATGATGGCGCAGAATTGCATCCTCGGACCTAT
GGTTCGATTTTTTCTTGGGGCCAAAACGACCAGCTTGGGGCTTTGGGTGTTCTGTATGTTATACTCGCGCTCATA
TTGGTCAATGGAAAGGTCGTACAAGAGCGAGCGCTGCGCGGTCAATTGAAAGAACTCGGTCTCCCATCCACCGCT
GGTCGCTCACCCATACTATTCACAACTATAGCTACACATCGCGCCATGAAAGTCGACGATTATCTTTCTCTACTT
CTTCGTCAGGGTTATCTCGACCGGCAAATTGTTGGCGAAGTTTCCGGCGCGGGCCGTAAACGGGCGAGAGGAAAA
GTCGGAGGTGACGCTCATAATGATATGGGTATGCAAGCTGGTGACATGTATGAGTGGCGGTGGGGCGCACGAGCG
TTTTGTGAGGTGGGTGAGACGGACATTGCGAAATTTGTTGCGGAATTTATGGTTAATTATAATACGGGTGGAAAA
GCTGGGGATGAGGAAGAGGATGATGAAGGGACTGAAGGAAGGAAGAAAACAAAGGTGGAGAAAATGTATATGGGC
GTACGTAAAGCTGCTGGAGGAAGTTTGGCTGCGATAAGGGACTGGAACAACTAA
Transcript >AgabiH97|023370
ATGGCTCCAACACGCAGACAAGCCTCGCAGTCCCAAAGACCAGCAAATGGACGATCGCAGCGTGATGGGCCAGCA
CGTTCGCAGGCGACCCGACGAGCACGGGTAGAGTCGGATGATGAAGTCGACGAAAATGAGATGGATGTCGACGCA
GAACATTCAGAAGCTGAGAATGCAGAAGGTGAAGGTGGGGCAGCTGATATCCGACTAAAGGCTGCGGATCTGGTT
CGACTAGCCCTATTTCACGAAGCACGGCGGATGCCATTGAGACGCGAAGATATCAATAAAAAAGTCCTACCAAAT
TCGACGAGGATTTTCAAAGCAGTCTTTGATCGGGCTCAGTCGATACTCCATGAGACGTTCGGTCTTCAACTCCAG
GAGCTACCATCGAAAGCTGGTTTGGATCAGGAAGCTGCAGCAGCGTCGGCAGAAAAAAAAGGAAAGAAGTCAACT
TCAGGTACGCAGGATCCCCAGGGTGAAGACGAGCTGGAAGAAGCTAGAAAGGCTACTATGGGAAAGAGACGAGCT
ACTGCTGTCGGATCAAAGACATACATTTTACGTTCCATCCTGGACGCTAGACTCATTGAGATAGCTAACAAAACG
GATGCTAGTATCGTGGAAGAGGAAGCTCTCCTTAACTTTGCTACTGGTGATCTCTTTGGTGGCGATGGCAACTCT
GGAGCTGGCGCTGCTATATTTTTGGATGATGACGATGAATGGGATGATGGCGCAGAATTGCATCCTCGGACCTAT
GGTTCGATTTTTTCTTGGGGCCAAAACGACCAGCTTGGGGCTTTGGGTGTTCTGTATGTTATACTCGCGCTCATA
TTGGTCAATGGAAAGGTCGTACAAGAGCGAGCGCTGCGCGGTCAATTGAAAGAACTCGGTCTCCCATCCACCGCT
GGTCGCTCACCCATACTATTCACAACTATAGCTACACATCGCGCCATGAAAGTCGACGATTATCTTTCTCTACTT
CTTCGTCAGGGTTATCTCGACCGGCAAATTGTTGGCGAAGTTTCCGGCGCGGGCCGTAAACGGGCGAGAGGAAAA
GTCGGAGGTGACGCTCATAATGATATGGGTATGCAAGCTGGTGACATGTATGAGTGGCGGTGGGGCGCACGAGCG
TTTTGTGAGGTGGGTGAGACGGACATTGCGAAATTTGTTGCGGAATTTATGGTTAATTATAATACGGGTGGAAAA
GCTGGGGATGAGGAAGAGGATGATGAAGGGACTGAAGGAAGGAAGAAAACAAAGGTGGAGAAAATGTATATGGGC
GTACGTAAAGCTGCTGGAGGAAGTTTGGCTGCGATAAGGGACTGGAACAACTAA
Gene >AgabiH97|023370
ATGGCTCCAACACGCAGACAAGCCTCGCAGTCCCAAAGACCAGCAAATGGACGATCGCAGCGTGATGGGCCAGCA
CGTTCGCAGGCGACCCGACGAGCACGGGTAGAGTCGGATGATGAAGTCGACGAAAATGAGATGGATGTCGACGCA
GAACATTCAGAAGCTGAGAATGCAGAAGGTGAAGGTGGGGCAGCTGTAAGCCACTATTCCAAAGATCTTTTTCTT
GCTGTATTCACCCTTTCCAGGATATCCGACTAAAGGCTGCGGATCTGGTTCGACTAGCCCTATTTCACGAAGCAC
GGCGGATGCCATTGAGACGCGAAGATATCAATAAAAAAGGTTCATTGCTTCCCAATTCCTGAGTCATCTTATTCT
GAAAGCGTCGCGTCATAAAGTCCTACCAAATTCGACGAGGATTTTCAAAGCAGTCTTTGATCGGGCTCAGTCGAT
ACTCCATGAGACGTTCGGTCTTCAACTCCAGGAGCTACCATCGAAAGCTGGTTTGGATCAGGAAGCTGCAGCAGC
GTCGGCAGAAAAAAAAGGAAAGAAGTCAACTTCAGGTACGCAGGATCCCCAGGGTGAAGACGAGCTGGAAGAAGC
TAGAAAGGCTACTATGGGAAAGAGACGAGGTCTGCCTAACCGTCGGTCGCATTATTGACCACCTATCTGACTCGA
ACTGTTATTTTTTTTTTCATAGCTACTGCTGTCGGATCAAAGACATACATTTTACGTTCCATCCTGGACGCTAGA
CTCATTGAGATAGCTAACAAAACGGATGCTAGTATCGTGGAAGAGGAAGCTCTCCTTAACTTTGCTACTGGTGAT
CTCTTTGGTGGCGATGGCAACTCTGGAGCTGGCGCTGCTATATTTTTGGATGATGACGATGAATGGGATGATGGC
GCAGAATTGCATCCTCGGACCTATGGTTCGATTTTTTCTTGGGGCCAAAACGACCAGCTTGGGGCTTTGGGTGTT
CTGTATGTTATACTCGCGCTCATATTGGTCAATGGAAAGGTCGTACAAGAGCGTAAGCTTTACTTTATTTTATCA
ATGAAATGGAGAATTGAAGTTTATTTTGTAGGAGCGCTGCGCGGTCAATTGAAAGAACTCGGTCTCCCATCCACC
GCTGGTCGCTCACCCATACTATTCACAACTATAGCTACACATCGCGCCATGAAAGTCGACGATTATCTTTCTCTA
CTTCTTCGTCAGGGTTATCTCGACCGGCAAATTGTTGGCGAAGTTTCCGGCGCGGGCCGTAAACGGGCGAGAGGA
AAAGTCGGAGGTGACGCTCATAATGATATGGGTATGCAAGCTGGTGACATGTATGAGTGGCGGTGGGGCGCACGA
GCGTTTTGTGAGGTGGGTGAGACGGACATTGCGAAATTTGTTGCGGAATTTATGGTTAATTATAATACGGGTGGA
AAAGCTGGGGATGAGGAAGAGGATGATGAAGGGACTGAAGGAAGGAAGAAAACAAAGGTGGAGAAAATGTATATG
GGCGTACGTAAAGCTGCTGGAGGAAGTTTGGCTGCGATAAGGGACTGGAACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail